KEGG   Bacillus subtilis subsp. subtilis 168: BSU19180
Entry
BSU19180          CDS       T00010                                 

Gene name
des
Definition
(RefSeq) fatty acid desaturase
  KO
K10255  acyl-lipid omega-6 desaturase (Delta-12 desaturase) [EC:1.14.19.23 1.14.19.45]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU19180 (des)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsu01004]
    BSU19180 (des)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.23  acyl-lipid (n+3)-(Z)-desaturase (ferredoxin)
     BSU19180 (des)
    1.14.19.45  sn-1 oleoyl-lipid 12-desaturase
     BSU19180 (des)
Lipid biosynthesis proteins [BR:bsu01004]
 Desaturase
  Omega
   BSU19180 (des)
SSDB
Motif
Pfam: FA_desaturase DUF2107 GPI2
Other DBs
NCBI-GeneID: 939668
NCBI-ProteinID: NP_389799
Pasteur: BG13518
BSORF: BG13518
UniProt: O34653
Position
2089396..2090454
AA seq 352 aa
MTEQTIAHKQKQLTKQVAAFAQPETKNSLIQLLNTFIPFFGLWFLAYLSLDVSYLLTLAL
TVIAAGFLTRIFIIFHDCCHQSFFKQKRYNHILGFLTGVLTLFPYLQWQHSHSIHHATSS
NLDKRGTGDIWMLTVNEYKAASRRTKLAYRLYRNPFIMFILGPIYVFLITNRFNKKGARR
KERVNTYLTNLAIVALAAACCLIFGWQSFLLVQGPIFLISGSIGVWLFYVQHTFEDSYFE
ADENWSYVQAAVEGSSFYKLPKLLQWLTGNIGYHHVHHLSPKVPNYKLEVAHEHHEPLKN
VPTITLKTSLQSLAFRLWDEDNKQFVSFRAIKHIPVSLPPDSPEKQKLRKNA
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgactgaacaaaccattgcacataaacaaaaacagctgacaaagcaagtcgctgcattt
gctcagcctgaaacaaaaaacagcctgattcagcttttaaacacgtttatcccattcttc
ggcctatggtttcttgcttatctcagcctcgatgtctcctatcttcttacgttagcatta
acggtgattgccgcaggttttctgacaagaatttttatcatcttccatgactgctgccat
caatcttttttcaaacaaaaacgctataaccacattctcggttttctgacaggtgtcctg
actttattcccgtatcttcaatggcagcacagccattcgattcatcatgcaactagcagc
aatctggataaacgcggaacaggagacatctggatgttaacagtaaacgaatataaagct
gcatccagacgaacaaagcttgcatacagactttatagaaacccgtttatcatgtttatt
ctcggaccgatttatgtttttctgatcacgaaccgttttaacaaaaaaggcgcaagacgc
aaggaacgtgtaaacacataccttacgaatctggcaattgtcgcgttggctgccgcttgc
tgtctgatctttggctggcaatcgtttttactggtgcaaggcccgatatttctgatttca
ggttcaatcggtgtttggctgttttatgtgcagcatacctttgaagattcttattttgaa
gcggatgaaaactggagctacgttcaggctgctgttgaaggcagctcattttataaactc
ccgaaactgcttcaatggctaacaggcaatattggttaccaccacgttcatcatttgagt
ccaaaggtgcctaactataagcttgaagttgctcatgaacatcacgaaccattaaaaaac
gtaccgacaatcaccttaaaaacaagcctgcaatcacttgcgttccgtctatgggatgaa
gataacaaacagtttgtgtcatttcgggctataaaacatatacctgtaagccttccgcct
gattcaccagaaaaacagaagctgcggaagaatgcctga

DBGET integrated database retrieval system