KEGG   Bacillus subtilis subsp. subtilis 168: BSU19200Help
Entry
BSU19200          CDS       T00010                                 

Gene name
desR
Definition
(RefSeq) transcriptional regulatory protein DesR
  KO
K07693  two-component system, NarL family, response regulator DesR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Module
bsu_M00479  DesK-DesR (membrane lipid fluidity regulation) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU19200 (desR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU19200 (desR)
Two-component system [BR:bsu02022]
 NarL family
  DesK-DesR [MD:M00479]
   BSU19200 (desR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 Sigma70_r4 HTH_40 HTH_23 HTH_11 HrcA_DNA-bdg Pyr_redox DUF2089 TnsD HTH_28 Glycos_transf_1 HTH_29
Motif
Other DBs
NCBI-GeneID: 939664
NCBI-ProteinID: NP_389801
Pasteur: BG13520
BSORF: BG13520
UniProt: O34723
Structure
PDB: 

Position
2091705..2092304
Genome map
AA seq 199 aa AA seqDB search
MISIFIAEDQQMLLGALGSLLNLEDDMEVVGKGTTGQDAVDFVKKRQPDVCIMDIEMPGK
TGLEAAEELKDTGCKIIILTTFARPGYFQRAIKAGVKGYLLKDSPSEELANAIRSVMNGK
RIYAPELMEDLYSEANPLTDREKEVLELVADGKNTKEIAQELSIKSGTVRNYISMILEKL
EVKNRIEAITRSKEKGWFK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgattagtatatttattgcagaagatcagcaaatgctgctgggcgctttaggatcactt
ctaaacctcgaagacgatatggaagtcgtaggcaaaggtacaaccggccaagatgctgtt
gattttgtcaaaaaacgccagcctgatgtatgtattatggacattgaaatgcccggaaaa
acagggcttgaagctgctgaggagctaaaagatacaggctgcaaaattatcatcttaacc
accttcgccagacccggttactttcagagagctattaaagctggcgttaaaggctatttg
ttaaaagacagtccgagtgaagagctggccaacgccatccgtagcgtcatgaacggaaaa
cgcatctatgcacctgaactgatggaggacttatacagcgaagctaaccctcttacagat
agagaaaaagaagtgctcgaacttgtggctgacggtaaaaacacaaaagaaatcgctcag
gaactcagcatcaaaagcgggacggtgcggaattatatctcaatgattctagaaaagctt
gaagtgaaaaatcgaattgaagccattacccggtcaaaagaaaaaggctggtttaaataa

DBGET integrated database retrieval system