KEGG   Bacillus subtilis subsp. subtilis 168: BSU19230
Entry
BSU19230          CDS       T00010                                 

Gene name
yocJ
Definition
(RefSeq) FMN-dependent NADH-azoreductase 1
  KO
K01118  FMN-dependent NADH-azoreductase [EC:1.7.1.17]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU19230 (yocJ)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.17  FMN-dependent NADH-azoreductase
     BSU19230 (yocJ)
SSDB
Motif
Pfam: Flavodoxin_2 FMN_red Flavodoxin_4
Other DBs
NCBI-GeneID: 939669
NCBI-ProteinID: NP_389804
Pasteur: BG13523
BSORF: BG13523
UniProt: O35022
Position
complement(2096350..2096976)
AA seq 208 aa
MSTVLFVKSSDRTAEEGVSTKLYEAFLAAYKENNPNDEVVELDLHKENLPYLGRDMINGT
FKAGQGMEMTEDEKKQAAIADKYLNQFVKADKVVFAFPLWNFTVPAVLHTYVDYLSRAGV
TFKYTQEGPVGLMGGKKVALLNARGGVYSEGPMAALEMSLNFMKTVLGFWGVQDLHTVVI
EGHNAAPDQAQEIVEKGLQEAKDLAAKF
NT seq 627 nt   +upstreamnt  +downstreamnt
atgtctacagttttatttgtaaaatcaagcgaccgtacagctgaagaaggcgtttcaact
aaactttacgaagctttcttagctgcttataaagaaaacaaccctaatgatgaagtggtt
gaattagatcttcataaggaaaaccttccttaccttggcagagatatgattaacggaaca
tttaaagcaggtcaaggaatggaaatgacagaagatgagaaaaaacaagcagcaattgct
gacaaatatctgaaccagtttgtaaaagctgacaaagttgttttcgcattcccgctttgg
aacttcacagtgccagcagtgcttcatacttatgttgattatctgtctcgcgcaggcgtt
acattcaaatacacacaagaaggaccagtcggtttaatgggcggcaaaaaagttgcgctt
cttaacgctcgcggcggtgtctactcagaaggaccaatggctgcacttgaaatgtcatta
aacttcatgaaaacagttcttggtttctggggtgttcaagacttgcacacagttgtcatc
gaaggacataacgcagcacctgatcaagcgcaagaaatcgttgaaaaaggtttacaagaa
gcaaaagatcttgctgcaaaattctaa

DBGET integrated database retrieval system