KEGG   Bacillus subtilis subsp. subtilis 168: BSU19240
Entry
BSU19240          CDS       T00010                                 

Gene name
yocK
Definition
(RefSeq) general stress protein 16O
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: zf-dskA_traR COMM_domain VASP_tetra Collagen_mid Gcd10p
Other DBs
NCBI-GeneID: 939676
NCBI-ProteinID: NP_389805
Pasteur: BG13524
BSORF: BG13524
UniProt: P80872
Position
complement(2097126..2097617)
AA seq 163 aa
MALTKEQTQHLYHKLLDMQKELSGEKKETESMTEEVGELSNGVDNHMADHGTLVTDRMTD
QTVKEIDRELLEEVNRALQKMKDGTYGVCEKTGQEIPYERLEAVPYARMTVEAQADVEDD
LETDAPSYEREFHEQVKDLSNKETIDQKSSQTYEILDREQDSK
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcactgacaaaagaacaaacacagcatctctatcataaattgctcgatatgcaaaaa
gaattgtctggcgagaaaaaggaaacagaatcaatgacggaagaagtgggggagctttcc
aatggggttgacaaccatatggcagaccacgggacgctcgtcacagaccggatgacagac
caaacagtgaaagagattgaccgggagctgttagaggaggtcaaccgtgcattacaaaag
atgaaagacggaacttatggcgtgtgtgaaaaaaccggccaagagattccttacgaaaga
cttgaagctgttccttatgcaagaatgacagttgaggcccaagctgatgtggaggatgat
ctggagacagatgctccttcttatgaaagagagtttcatgaacaggtaaaagacttatcc
aacaaagaaacaattgatcaaaaaagctcgcagacgtatgaaatcttggatcgtgaacaa
gattcgaagtaa

DBGET integrated database retrieval system