KEGG   Bacillus subtilis subsp. subtilis 168: BSU19250
Entry
BSU19250          CDS       T00010                                 

Gene name
yocL
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: GerPC LPD25
Other DBs
NCBI-GeneID: 939586
NCBI-ProteinID: NP_389806
Pasteur: BG13525
BSORF: BG13525
UniProt: O34976
Position
complement(2097692..2098024)
AA seq 110 aa
MKKMFRSLIRHCLKPELDKLRECEERLSVIEKQKQSSKQESEETYIHIETLNVEKVDYHL
EFGELTIDELSGRLNIGATYYIPPEEKDKKCQRKPEAPSTPAVTIRSKRQ
NT seq 333 nt   +upstreamnt  +downstreamnt
atgaaaaaaatgttccggtcgctgatcaggcattgcttgaaaccagaacttgacaaactg
cgtgaatgtgaagaaagactctcagtgattgagaaacaaaaacaaagcagcaaacaagag
tctgaagaaacctatatacatattgaaacgctgaatgtcgaaaaagttgactatcatctt
gaattcggcgagctgaccattgatgaactgagcggcagattaaatataggcgcaacctat
tatataccgccagaagagaaggacaaaaagtgccaacgaaaacccgaagcaccatcgacg
ccagcggtcacgatccgttcaaaaaggcagtag

DBGET integrated database retrieval system