KEGG   Bacillus subtilis subsp. subtilis 168: BSU19259
Entry
BSU19259          CDS       T00010                                 

Gene name
yoyB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8303149
NCBI-ProteinID: YP_003097740
UniProt: C0H429
Position
2098102..2098329
AA seq 75 aa
MLPTNINISHLKTNSIGTGSSLTFGSAELRNRCSAIKRNNGFGEQNADGIVMVIPIESID
DRDVSDALSMKINHQ
NT seq 228 nt   +upstreamnt  +downstreamnt
atgcttccgactaacatcaatatttctcatctcaagactaactcgataggcaccggctca
tcccttacctttggttctgcggagttaaggaacaggtgctctgctatcaaaagaaataac
ggttttggggaacaaaatgcagatggtattgttatggtcattccgattgaatcaattgat
gaccgtgatgtgtcagatgcactcagtatgaaaatcaatcatcaataa

DBGET integrated database retrieval system