KEGG   Bacillus subtilis subsp. subtilis 168: BSU19260
Entry
BSU19260          CDS       T00010                                 

Gene name
yocM
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HSP20 ArsA_HSP20
Other DBs
NCBI-GeneID: 939587
NCBI-ProteinID: NP_389808
Pasteur: BG13526
BSORF: BG13526
UniProt: O34321
Position
complement(2098316..2098792)
AA seq 158 aa
MDFEKMKQWMEFAQQMYGGDFWKQVFDEDQKTPFMTNGQSPFPFAQQDQRGKGDASFPSM
DIVDTVAEVQFLIYLPGYRKQDVHILSYGDYLVVKGQRFSYFNEQDFRQKEGKYGSFEKK
IPLSDHLHGKMNAIFKDGILYITIQKDEGQAKTIVIDD
NT seq 477 nt   +upstreamnt  +downstreamnt
atggatttcgaaaagatgaagcagtggatggaattcgcacagcagatgtacggcggtgac
ttttggaaacaggtatttgatgaagaccaaaaaaccccttttatgacaaatggccaatct
ccgtttccgtttgcgcagcaagatcagcgagggaaaggagatgcttcatttccgagcatg
gatattgtagataccgttgcggaagtgcagtttttaatttatcttccaggctaccgtaaa
caagacgttcacatattatcgtacggagattatttagtggtgaaggggcagcgcttttcc
tattttaatgaacaggactttcgccaaaaagaagggaaatacggaagttttgaaaagaaa
attccgctttccgatcatcttcatggaaagatgaatgccatttttaaagacggaatccta
tacatcactattcaaaaagacgaaggtcaagcgaaaaccattgttattgatgattga

DBGET integrated database retrieval system