KEGG   Bacillus subtilis subsp. subtilis 168: BSU19270
Entry
BSU19270          CDS       T00010                                 

Gene name
yozN
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: gerPA
Other DBs
NCBI-GeneID: 939679
NCBI-ProteinID: NP_389809
Pasteur: BG13761
BSORF: BG13761
UniProt: O31846
Position
2098859..2099122
AA seq 87 aa
MVQPTPYININIFMLKINSFENASAVNVGQNLLAEWQNSDKKNQGYGQNFGDASGFMGTR
SHVDDRDQIDSPASFESEAVNSSIKRK
NT seq 264 nt   +upstreamnt  +downstreamnt
gtggttcaaccaactccgtatatcaatattaatattttcatgctgaaaattaattccttt
gaaaatgcttcagcggttaacgtaggacaaaatttattggcagaatggcaaaattcagat
aaaaaaaatcaaggctacggacagaattttggagatgcgagcggatttatgggcacgaga
agccatgtggatgacagagaccaaattgattctccggcctcttttgaaagtgaagcggtt
aactcctcaatcaaaaggaagtga

DBGET integrated database retrieval system