KEGG   Bacillus subtilis subsp. subtilis 168: BSU19280
Entry
BSU19280          CDS       T00010                                 

Gene name
yocN
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: gerPA
Other DBs
NCBI-GeneID: 939594
NCBI-ProteinID: NP_389810
Pasteur: BG13527
BSORF: BG13527
UniProt: O34855
Position
2099127..2099360
AA seq 77 aa
MFFSPSVVNVGGFKINTMDRGSSLTLGPYQQVDYFLSAKINQGFGEENGDFTPLVVPISN
VLDADLVDSNSAKNSVV
NT seq 234 nt   +upstreamnt  +downstreamnt
atgttcttttcaccctccgtcgtaaatgtcggcggatttaaaatcaatacgatggatcga
ggttcctctttaacactcggtccgtatcagcaggtcgattactttttatcagctaaaata
aatcaagggtttggagaagaaaatggcgactttactcctcttgtcgtgccgatttcaaat
gtattagatgcagatcttgttgattcgaactcagcgaaaaacagtgtggtgtaa

DBGET integrated database retrieval system