KEGG   Bacillus subtilis subsp. subtilis 168: BSU19290
Entry
BSU19290          CDS       T00010                                 

Gene name
yozO
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: bPH_1 bPH_3 GRAM Vps36_ESCRT-II
Other DBs
NCBI-GeneID: 939681
NCBI-ProteinID: NP_389811
Pasteur: BG13762
BSORF: BG13762
UniProt: O31847
Position
complement(2099446..2099790)
AA seq 114 aa
MGIFSVSRSTDAKKLEALLVEGERIESIYKLRVDQICFTNKRIIFFDNKMFSKKKVRVFL
PYKTIESFAIQEAGMFDPDTGLLLMTRSKTFELEFAKDTDLSEVQAVLTKHLCS
NT seq 345 nt   +upstreamnt  +downstreamnt
ttgggtattttttctgttagcagatcaacggacgcaaagaagcttgaggctttgctcgtt
gaaggggaaagaattgaatcgatttataagctccgagtggaccaaatttgctttacaaat
aagcggatcattttctttgacaataaaatgttttctaaaaagaaggttcgtgtatttctt
ccatataaaacaattgaaagctttgccatccaagaagcgggaatgtttgatccggacact
gggcttttattgatgacaagaagcaaaactttcgaattagaatttgcgaaagacaccgat
ttaagcgaggttcaggcggtgctgacaaagcatttgtgcagctga

DBGET integrated database retrieval system