KEGG   Bacillus subtilis subsp. subtilis 168: BSU19300Help
Entry
BSU19300          CDS       T00010                                 

Gene name
yozC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4115
Motif
Other DBs
NCBI-GeneID: 939998
NCBI-ProteinID: NP_389812
Pasteur: BG13750
BSORF: BG13750
UniProt: O31848
Position
complement(2100147..2100350)
Genome map
AA seq 67 aa AA seqDB search
MIHKNWLEKETIKKVKCVQTNAKKYIVNRVLTPGKEYEVKNETEEFLFVVDNTNKVGGYY
KEYFEEM
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgattcataaaaattggcttgaaaaagaaaccattaaaaaagtaaagtgtgtgcagaca
aacgcaaaaaaatatatcgtaaaccgcgttttaacgccgggaaaagaatatgaagtaaaa
aatgaaacagaggagtttctctttgtggtcgacaatacgaataaagtcggcggctattat
aaagaatacttcgaagagatgtaa

DBGET integrated database retrieval system