KEGG   Bacillus subtilis subsp. subtilis 168: BSU19320
Entry
BSU19320          CDS       T00010                                 

Gene name
sqhC
Definition
(RefSeq) sporulenol synthase
  KO
K18115  sporulenol synthase [EC:4.2.1.137]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU19320 (sqhC)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.137  sporulenol synthase
     BSU19320 (sqhC)
SSDB
Motif
Pfam: SQHop_cyclase_C SQHop_cyclase_N Prenyltrans TED_complement
Other DBs
NCBI-GeneID: 939443
NCBI-ProteinID: NP_389814
Pasteur: BG12679
BSORF: BG12679
UniProt: Q796C3
Position
2102168..2104066
AA seq 632 aa
MGTLQEKVRRFQKKTITELRDRQNADGSWTFCFEGPIMTNSFFILLLTSLDEGENEKELI
SSLAAGIHAKQQPDGTFINYPDETRGNLTATVQGYVGMLASGCFHRTEPHMKKAEQFIIS
HGGLRHVHFMTKWMLAANGLYPWPALYLPLSLMALPPTLPIHFYQFSSYARIHFAPMAVT
LNQRFVLINRNISSLHHLDPHMTKNPFTWLRSDAFEERDLTSILLHWKRVFHAPFAFQQL
GLQTAKTYMLDRIEKDGTLYSYASATIYMVYSLLSLGVSRYSPIIRRAITGIKSLVTKCN
GIPYLENSTSTVWDTALISYALQKNGVTETDGSVTKAADFLLERQHTKIADWSVKNPNSV
PGGWGFSNINTNNPDCDDTTAVLKAIPRNHSPAAWERGVSWLLSMQNNDGGFSAFEKNVN
HPLIRLLPLESAEDAAVDPSTADLTGRVLHFLGEKVGFTEKHQHIQRAVKWLFEHQEQNG
SWYGRWGVCYIYGTWAALTGMHACGVDRKHPGIQKALRWLKSIQNDDGSWGESCKSAEIK
TYVPLHRGTIVQTAWALDALLTYENSEHPSVVKGMQYLTDSSSHSADSLAYPAGIGLPKQ
FYIRYHSYPYVFSLLAVGKYLDSIEKETANET
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgggcacacttcaggagaaagtgaggcgttttcaaaagaaaaccattaccgagttaaga
gacaggcaaaatgctgatggttcatggacattttgctttgaaggaccaatcatgacaaat
tccttttttattttgctccttacctcactagatgaaggcgaaaatgaaaaagaactgata
tcatcccttgcagccggcattcatgcaaaacagcagccagacggcacatttatcaactat
cccgatgaaacgcgcggaaatctaacggctaccgtccaaggatatgtcgggatgctggct
tcaggatgttttcacagaactgagccgcacatgaagaaagctgaacaatttatcatctca
catggcggtttgagacatgttcattttatgacaaaatggatgcttgccgcgaacgggctt
tatccttggcctgctttgtatttaccattatcactcatggcgctccccccaacattgccg
attcatttctatcagttcagctcatatgcccgtattcattttgctcctatggctgtaaca
ctcaatcagcgatttgtccttattaaccgcaatatttcatctcttcaccatctcgatccg
cacatgacaaaaaatcctttcacttggcttcggtctgatgctttcgaagaaagagatctc
acgtctattttgttacattggaaacgcgtttttcatgcaccatttgcttttcagcagctg
ggcctacagacagctaaaacgtatatgctggaccggattgaaaaagatggaacattatac
agctatgcgagcgcaaccatatatatggtttacagccttctgtcacttggtgtgtcacgc
tattctcctattatcaggagggcgattaccggcattaaatcactggtgactaaatgcaac
gggattccttatctggaaaactctacttcaactgtttgggatacagctttaataagctat
gcccttcaaaaaaatggtgtgaccgaaacggatggctctgttacaaaagcagccgacttt
ttgctagaacgccagcataccaaaatagcagattggtctgtcaaaaatccaaattcagtt
cctggcggctgggggttttcaaacattaatacaaataaccctgactgtgacgacactaca
gccgttttaaaggcgattccccgcaatcattctcctgcagcatgggagcggggggtatct
tggcttttatcgatgcaaaacaatgacggcggattttctgctttcgaaaaaaatgtgaac
catccactgatccgccttctgccgcttgaatccgccgaggacgctgcagttgacccttca
accgccgacctcaccggacgtgtactgcactttttaggcgagaaagttggcttcacagaa
aaacatcaacatattcaacgcgcagtgaagtggcttttcgaacatcaggaacaaaatggg
tcttggtacggcagatggggtgtttgctacatttacggcacttgggctgctcttactggt
atgcatgcatgcggggttgaccgaaagcatcccggtatacaaaaggctctgcgttggctc
aaatccatacaaaatgatgacggaagctggggagaatcctgcaaaagcgccgaaatcaaa
acatatgtaccgcttcatagaggaaccattgtacaaacggcctgggctttagacgctttg
ctcacatatgaaaattccgaacatccgtctgttgtgaaaggcatgcaataccttaccgac
agcagttcgcatagcgccgatagcctcgcgtatccagcagggatcggattgccgaagcaa
ttttatattcgctatcacagttatccatatgtattctctttgctggctgtcgggaagtat
ttagattctattgaaaaggagacagcaaatgaaacgtga

DBGET integrated database retrieval system