KEGG   Bacillus subtilis subsp. subtilis 168: BSU19330
Entry
BSU19330          CDS       T00010                                 

Gene name
sodF
Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BSU19330 (sodF)
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-GeneID: 939503
NCBI-ProteinID: NP_389815
Pasteur: BG12676
BSORF: BG12676
UniProt: O35023
Position
2104056..2104901
AA seq 281 aa
MKRESYQAEMFNWCEALKDQIQKRGQLDQFEDQIDKMIEALEDDQTTEEDWYKQAAALYR
DITESDDTSERRAYVPIGKHVLPKLPYKYSALEPYISRDIMILHHTKHHQSYVDGLNKAE
SELKKARATKNYDLITHWERELAFHGAGHYLHSIFWFSMHPNGKRRPTGALFQMIDLSFG
SYSAFKEHFTQASKKVEGVGWAILVWAPRSGRLEILTAEKHQLFSQWDVIPLLPLDVWEH
AYYLQYKNDRASYVDHWWNVVDWREAEKRFEQAKEVVWKLY
NT seq 846 nt   +upstreamnt  +downstreamnt
atgaaacgtgaatcttatcaagcggagatgttcaattggtgtgaagccctgaaagatcag
attcaaaagcgaggtcagcttgaccagtttgaagatcaaatcgacaagatgattgaggct
ctggaagatgaccaaacaacagaagaagattggtataaacaggccgctgccctttatcgg
gatattacagaatcagatgatacaagtgaaagacgcgcttatgtccctatagggaaacac
gtgctgccaaagcttccttacaaatactccgccttagaaccttatatatcacgcgatatt
atgatccttcatcatacaaaacatcatcaaagctatgtcgatggcctgaacaaagcagaa
tcagagcttaaaaaagcgagagcgacaaagaattatgacttaatcactcattgggaaaga
gagcttgcgttccatggagcaggccattatttgcatagtattttttggttttctatgcat
ccaaacggaaaacggcgtcctacaggggcattgttccaaatgatagacctttcatttgga
agctattccgcttttaaagaacattttacccaggcctctaaaaaagtggaaggcgtcggc
tgggccattctggtctgggcacctcgatcaggacggctggagattttaacggcagaaaaa
caccagctctttagccaatgggatgtgatcccccttttaccgcttgacgtatgggagcat
gcctactatttgcaatacaaaaatgaccgggccagctatgtcgatcactggtggaatgtc
gtggattggcgcgaggctgaaaaacgttttgagcaggcaaaagaagtcgtttggaagctc
tattaa

DBGET integrated database retrieval system