KEGG   Bacillus subtilis subsp. subtilis 168: BSU19340
Entry
BSU19340          CDS       T00010                                 

Gene name
yocR
Definition
(RefSeq) sodium-dependent transporter YocR
  KO
K03308  neurotransmitter:Na+ symporter, NSS family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU19340 (yocR)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 939450
NCBI-ProteinID: NP_389816
Pasteur: BG13528
BSORF: BG13528
UniProt: O34383
Position
complement(2104934..2106271)
AA seq 445 aa
MKEANQWSSKLGFILAAAGSAIGLGAIWKFPYVAGTSGGGAFLLIFILFTVLIGLPLLLG
EFIIGRRTQKDAVQSYKTLAPGTKWHWIGYLGMVTCFILLSFYSVVGGWILIYIIKGFTG
GLSQTSGFDTIFASTISNPYLAVGGQLLFMVVTILVVAKGVSSGIEKASQVLMPALFLLF
IILMVRSVTLDGAMEGIKFFLMPDLTAIDANTILYAMGQSFFLLSVGVSVMVTYSAYLEK
QENLVQSAVSVTVMNMLVAVMAGIAIFPAVFSFGLKPDQGPVLLFNVLPTVFNQMPFGII
FLLAFLLLFLFAALTSAFSMLEILVAVLSKGDINKRKRFAWLGGIAIFIVGVPSALSYGV
LSDVTIFHLSIFDAADYLVSNILMPLGALLISIFVPLKIPKQDLFDELKSGSNLKRKWFA
VWLLLIRYLSPVAIIIVFLHVIGIF
NT seq 1338 nt   +upstreamnt  +downstreamnt
gtgaaggaagcaaatcaatggtcttcgaagctcggctttattttagccgcggcaggatca
gctatcgggcttggtgcgatatggaaattcccatatgttgccggaaccagcggaggaggc
gcatttttacttatttttattttatttacggttttaatcggactgcctttattgttaggt
gaattcatcataggcagaagaacacagaaagatgccgttcagtcctataaaacacttgct
ccaggaacgaagtggcattggatcggttatttaggcatggtgacgtgctttattcttcta
tctttctacagtgtcgtaggcggatggattttaatttatattataaaaggcttcactggc
ggtttatcgcaaacatctggttttgatacgatatttgcaagtaccatttcaaatccttat
ttggctgtaggaggccagctgctctttatggtggtaacaattttagttgttgcaaaaggg
gtaagcagcggaattgaaaaagcaagccaagtattaatgccggcgctttttctattattc
atcattttaatggtgcgttcggttacacttgatggcgcgatggaaggaatcaaatttttc
ctcatgcctgatttaactgcaattgatgccaataccattttatatgcaatgggacaatcc
tttttcttattaagtgtcggtgtatctgtcatggtaacgtatagcgcttatttagagaaa
caggaaaatctggtacagtccgctgtatctgtaactgttatgaacatgcttgttgctgta
atggccggaattgcgatttttccagctgtattttcattcggcctcaagccagaccaaggc
ccggttctgttatttaacgttctgccgactgtgtttaatcaaatgccgttcggaattatc
tttttattagcatttttacttctatttttatttgctgcattgacatctgctttttcaatg
ctggaaattttggtcgcagtactgtcgaaaggcgatatcaataagagaaaacgattcgct
tggttaggcggtattgctatttttattgtcggtgtgccgtctgcattatcatacggtgtc
ttaagtgacgtcactatatttcatctgtctatttttgatgcggctgactatcttgtgagc
aatattttaatgccgttaggtgcgttactgatttcgatttttgttccgctaaaaataccg
aaacaggatttgtttgacgagctgaaaagcggttccaatctcaaacgaaagtggtttgcg
gtttggctgctgctcattcgatatctatctcctgttgccatcatcatcgtgtttttgcat
gtgataggtattttttaa

DBGET integrated database retrieval system