KEGG   Bacillus subtilis subsp. subtilis 168: BSU19350
Entry
BSU19350          CDS       T00010                                 

Gene name
yocS
Definition
(RefSeq) sodium-dependent transporter YocS
  KO
K03453  bile acid:Na+ symporter, BASS family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU19350 (yocS)
SSDB
Motif
Pfam: SBF SBF_like Mem_trans SLATT_5
Other DBs
NCBI-GeneID: 939452
NCBI-ProteinID: NP_389817
Pasteur: BG13529
BSORF: BG13529
UniProt: O34524
Position
2106490..2107455
AA seq 321 aa
MDIIRKISHFAGQTFGIWVIVFAVLGFSFPSLFTWISSYITIFLGIIMFGMGLTLQADDF
KELVRKPWQVIIGVIAQYTIMPLVAFGLAFGLHLPAEIAVGVILVGCCPGGTASNVMTFL
AKGNTALSVAVTTISTLLAPVVTPLLIMLFAKEWLPVSPGSLFISILQAVLFPIIAGLIV
KMFFRKQVAKAVHALPLVSVIGIVAIVSAVVSGNRENLLQSGLLIFSVVILHNGIGYLLG
FLCAKLLKMDYPSQKAIAIEVGMQNSGLGAALATAHFSPLSAVPSAIFSVWHNLSGSMLA
TYWSKKVKKKQAGSKSSNLSL
NT seq 966 nt   +upstreamnt  +downstreamnt
atggacatcattagaaaaataagccattttgcaggacaaacctttggcatatgggtcatt
gtttttgcagtgctgggattttctttcccatctttatttacgtggatcagttcttatatt
acgatttttctcggcattatcatgtttgggatgggccttacactgcaagccgatgatttc
aaagagctggtcagaaagccttggcaagttattattggagtaatagctcagtatacgatc
atgccgctcgttgctttcggcctcgcatttgggcttcatcttccagctgaaatcgcagtt
ggtgttattcttgtcggctgctgtcccgggggaactgcatctaatgttatgacattctta
gcaaaaggaaatactgccctttctgttgcggttacgacaatttctaccttattggcacct
gttgtaacaccgttgttgattatgctgtttgccaaagaatggcttcctgtctcgccgggg
tctttgtttatctcaatcttacaggcggttttatttccgatcattgcaggtctgattgtc
aaaatgtttttcagaaaacaagtggcaaaagccgtacatgcccttccgcttgtttctgtc
attggcatcgttgcgattgtctcagctgtcgtcagcggcaatcgggaaaatctgcttcaa
tcggggttgctcattttttcagttgttatcctgcataacggtatcggttatttactgggg
tttctttgtgcaaagcttttaaaaatggattacccgtctcaaaaagcgattgcaatcgaa
gtcggcatgcaaaactccgggcttggggctgcacttgccacggctcatttctcaccgcta
tctgccgtaccaagcgcaatattcagtgtgtggcataacctttcaggttctatgcttgca
acatattggtcaaaaaaagtgaaaaagaagcaagctggatccaaaagcagcaatctatca
ctttaa

DBGET integrated database retrieval system