KEGG   Bacillus subtilis subsp. subtilis 168: BSU19370
Entry
BSU19370          CDS       T00010                                 

Gene name
sucA
Definition
(RefSeq) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00020  Citrate cycle (TCA cycle)
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
Module
bsu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSU19370 (sucA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BSU19370 (sucA)
SSDB
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N Amidinotransf
Other DBs
NCBI-GeneID: 939507
NCBI-ProteinID: NP_389819
Pasteur: BG10272
BSORF: BG10272
UniProt: P23129
Position
complement(2108774..2111608)
AA seq 944 aa
MFQNSMKQRMNWEDFYGPNLGYALELYDQYTQDPNSIDPDLKEMFDELGAPPSDIKEASG
TKEKGRVTADLIQKIASAVRLAEDIRTYGHLNASVNPLRKDEKKSELFPLSDYGLTEEEI
KAIPASVICKDAPKNISNGLEAIQYLRNTYKRTISFEFDHVHDFKEREWLTRKIESGELF
QKNSAEKLSAVLERLTEVEGFEQFLHRTFVGQKRFSIEGLDALVPVLDDIIAQSVKSGTT
SVNIGMAHRGRLNVLAHVLGKPYEIIFSEFQHAPNKDLVPSEGSIGISYGWTGDVKYHLG
ANRELQDAETKSARITLANNPSHLEFINPIVEGSTRAAQETRTQSGYPVQDETKSLAILI
HGDAAFPGEGIVAETLNLSSLKGYQVGGAIHIIANNMIGFTTESAESRSTKYASDLAKGY
EIPIVHVNADDPEACLSAVKFAVEYRKTFNKDFLIDLIGYRRYGHNEMDEPSTTQPMLYD
AVRKHPTVKQIFAEKLVKEGVVTEEVVQNIEKSVTKRIEDAYQKVPSKKEHTACEIELPE
PVSNGFPDVDTSIDFDVLRKLNGELINWPESFNVFGKLKRILERRAKAFDDDRKVEWSLA
ESLAFASILKDGTPIRLTGQDSERGTFAQRNLVLHDSETGKEFVPLHHLSDCSTSFAVHN
SPLSEGSVLGFEYGYNVHSPETLVLWEAQYGDFANAAQVYFDQFISAGRAKWGQKSGLVM
LLPHGYEGQGPEHSSGRIERFLQLAAENNWTVANLTSAAQYFHILRRQAKMLLREEIRPL
VIMTPKSLLRNPNTVSEVQELSESRFQPVYEQSGLSHDYEKVTRLVLSSGKVSIDISDHF
NKLEDGKEWLHIARIEQLYPFPAKGVKELFAKLPNLKEIVWVQEEPQNMGAWGYISPYLT
EIAPEGVSVQYIGRRRRSSPAEGDPTVHKKEQERIVSDSLTRKN
NT seq 2835 nt   +upstreamnt  +downstreamnt
atgtttcaaaatagtatgaaacaacgaatgaattgggaagatttttacggtccgaacctc
ggctatgcgctggagctttacgatcagtatacccaggatccgaacagcattgacccggat
ttgaaggaaatgttcgacgagctcggtgctccgccaagcgatataaaagaggcctcggga
acaaaagaaaagggacgtgttacagccgatctgattcaaaagatcgcatccgcagtcaga
cttgcagaagatatccgaacctatggccatttgaacgcttccgtcaatccgctcagaaag
gatgagaaaaagagcgaactttttccattatccgattacgggctaacagaagaggaaata
aaagcaatacctgcgtctgtcatctgcaaagacgctcctaaaaacatttcgaacggttta
gaagccattcagtatttacgaaatacgtataaaagaaccatctcttttgaatttgaccat
gtgcatgacttcaaagagcgcgagtggctgacaagaaagattgaatctggcgagctgttc
cagaagaactcagctgaaaagctgtcagctgtgctggaaagattgacagaagtagagggc
tttgagcagtttttgcaccgcacattcgtcgggcagaagcgcttttccattgagggtctg
gacgctcttgttccagtgcttgatgacattattgcacaatctgtcaaatcaggcacgaca
agtgtcaacatcgggatggcgcacaggggacgcctgaatgtcttggcacatgtgctcggc
aaaccgtatgaaatcatcttctctgaattccagcatgcgccgaacaaagatcttgtaccg
tctgagggatccattggaatcagctacggatggacgggggatgtcaaataccatttgggg
gcgaatcgggagcttcaagacgctgaaacaaaatcagcgcgcattacgttagcgaacaac
ccgagccacttggaatttatcaatccgattgttgaaggcagcacaagagcggcacaggaa
acgcgaacacaaagcggatacccggtacaagatgaaacaaaatcgctggccattttaatc
catggagacgctgcattccctggggaaggaattgtagctgaaacattgaatttaagctct
ttaaaagggtatcaagtaggcggtgcgattcatattatcgccaataacatgatcggattc
acaacagaaagcgctgaatccagatcgacaaaatatgccagcgacctggccaagggttat
gaaattccgattgttcacgtgaatgcggacgatcctgaagcttgtctttcagctgttaag
tttgcggtcgaataccgaaaaacattcaacaaggattttctgattgatttgatcgggtac
agacgctatggacacaacgaaatggatgaaccgtcaaccactcagccaatgctgtatgat
gctgtcagaaagcatccgaccgtcaaacaaattttcgctgaaaagctggtaaaagaaggc
gtggttaccgaggaagtcgttcaaaacatcgaaaaatcggtaacgaagcgcattgaggat
gcatatcagaaagttccgtctaaaaaggaacacactgcttgtgaaattgaacttccagag
cctgtatcaaacggtttcccagatgtggacacttcgattgattttgatgtgctccgcaag
ctgaatggcgaattgatcaactggccggagtcatttaatgttttcggcaagctaaagcgc
attttagaaagacgcgccaaggcgttcgatgatgacagaaaagtggaatggtctttggca
gaatcactcgcgtttgcttcaattttgaaagacggaacaccgattcgtttaacaggacag
gattccgagcgcggaacgttcgcccaaagaaaccttgtgcttcatgacagtgagacgggc
aaagaatttgtgccgcttcatcacttatctgactgcagcacatcatttgctgttcataac
agcccgctgtctgaaggatcggttctcggttttgaatacggctataacgtgcattcaccg
gaaacgcttgttttgtgggaagcacagtacggagattttgccaacgctgctcaagtgtat
tttgaccaatttatttctgccggacgcgcgaaatggggccaaaaatccggattagtcatg
ctgctcccgcacggttacgagggacaggggcctgagcactcaagcggaagaattgagcga
ttcctgcagcttgcagcggaaaacaactggacggttgccaacctgacaagcgcggcacag
tatttccatattttaagaagacaggctaaaatgctgcttcgtgaagaaatcagaccgctc
gtcattatgacgccgaagagccttcttcgcaacccaaatacggtgtcggaagtgcaggag
ctcagcgaaagccgcttccagcctgtttatgaacagtcgggactttctcatgactatgaa
aaagtaaccagacttgtattatccagcggtaaagtgtctatagacattagcgatcatttt
aataagttagaagacggtaaagagtggcttcacattgcgagaatcgaacagctgtatcca
ttcccggcaaaaggagtcaaagaattatttgcaaaacttccgaacctgaaagaaatcgtt
tgggtgcaggaagagccgcagaacatgggggcttggggttatatcagcccgtatttgaca
gagattgcaccagagggagtaagcgttcaatatattggacgaagaagacgatccagccct
gcagagggagatccgacagttcataaaaaagaacaggaacgtattgtatctgatagcttg
actcgcaaaaactaa

DBGET integrated database retrieval system