KEGG   Bacillus subtilis subsp. subtilis 168: BSU19380
Entry
BSU19380          CDS       T00010                                 

Gene name
yojO
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: VWA CobT_C VWA_2
Other DBs
NCBI-GeneID: 939499
NCBI-ProteinID: NP_389820
Pasteur: BG13567
BSORF: BG13567
UniProt: O31849
Position
complement(2111837..2113753)
AA seq 638 aa
MKFIKFNDSTIDSFLFMMLTDLAKTLTKSEAVEVEYGVQSYYNPFEKKIYMSHFWKDRAA
EDMEAGLKSDVYLRSVGTRYSSLHEFANFLNDIHRHLTFKSFAKQLFMLLEDIRIEECIK
RERPGTKHVFAKRKDMYRKHFSTQLTLNLERSIFTDALFCAIYFKLTAESPLETLPSMRE
DIDLMRPFIEQQLLRVYEADSTRQVLKIVEDLMDGLEEVLDKDMLNTYFFLPELDYAKAA
EQPLFEEEKKAPKLSDDITLPKQSDGDEDIHEEEMPTWHRETEAPSKSFLQFDIEHGAKS
DLGKDASREGDDGDQALGSVQGSARQTKRKDYSKLEALESQKDQPNGAGMADGKENKYAF
PIYKEPQPATSEEELSYKQQAKTIESYQKRLKQMIQKTLEHKKTLPRTDLHAGRLNNKLL
RYFTERNPRLFYKKQEPSSEIDAVFTLLVDCSASMFDKMDETKRGIVLFHEALKSVAVPH
QIVGFWEDTNDATEKSQPNYFNTVIPFQSSLRQDSGPAIMQLEPEEDNRDGYAIRQMTKK
MLHRSEAQKFLIVFSDGEPAAFGYEQNGIVDTSEAVIEARKRGIEVINVFLSNSEIEESQ
MKTIQDMYGKFSIFVPDVDQLPDVLYPLLKKLLHKSIG
NT seq 1917 nt   +upstreamnt  +downstreamnt
atgaaatttatcaaatttaacgacagcacgattgattcatttttatttatgatgctgact
gatttggccaaaacactcaccaagagtgaagcggtagaagtggagtatggcgttcagtcc
tattacaatccatttgaaaagaaaatctatatgagccacttttggaaagacagggcagct
gaggacatggaagcgggtctgaaaagcgacgtctacctgcgttcagtcggaacaagatat
agctcgctgcatgagtttgcgaactttttgaatgatatccatcgccatcttacgtttaaa
agttttgccaagcagctctttatgctgcttgaagacattaggatcgaagaatgcatcaaa
cgtgagcgcccgggtacgaaacatgtatttgcgaagcgaaaagacatgtacagaaaacat
ttctcaacccagctgaccttaaatttggaacgaagcatttttaccgatgcgctcttttgc
gcgatctatttcaagctcacagcggaatcgccgctcgagacccttccatccatgcgtgaa
gatatcgatctgatgcgcccgtttattgagcagcagctcttgcgtgtgtatgaagcagat
tcgacacggcaggttctgaaaattgttgaggacctcatggacggacttgaagaggtactc
gataaagacatgttgaacacctacttctttttgcctgagcttgattacgcaaaagctgca
gaacagccgttatttgaagaagagaaaaaagcgccgaagctgagtgatgacatcacgctt
ccaaaacaatcagacggtgatgaggatatccatgaagaagaaatgccgacatggcaccgg
gaaacagaagcaccgtctaaaagcttccttcaatttgatattgaacacggcgcaaaatca
gatttaggaaaagatgcttcaagggaaggcgacgatggagatcaggcccttggctctgtt
caaggatcagccagacaaacgaaacggaaagactattccaagctggaagcgctggagtcc
caaaaagaccagccgaacggagcgggtatggctgacggcaaagaaaataaatatgcattt
ccaatttataaagaaccgcagccggcaaccagtgaagaagagctttcttataaacagcag
gcaaaaacgattgaatcgtatcaaaagcgtttgaaacaaatgattcaaaaaacgctggag
cataaaaaaacattgccgagaacagaccttcatgccgggagactgaacaataagcttctt
cgttacttcactgagcgaaatccgcgcctgttctacaaaaagcaagaaccatcttcagaa
atcgacgcagtttttacattgctggtcgattgttccgccagcatgttcgacaaaatggac
gaaacaaaacgaggaatcgtgctgtttcacgaagcgttgaaatcggtagcggttccgcat
cagattgtcggtttttgggaggacacaaatgatgcaaccgaaaaaagccagccaaactat
ttcaatacggttattcccttccaatcatcattaagacaagattctggaccggccattatg
cagcttgagccagaagaagataaccgtgacgggtacgcaattaggcagatgacgaaaaaa
atgctgcatcgcagcgaggcgcaaaagttcttaattgttttctcagatggagagccggcc
gcatttggctacgaacaaaatgggatcgttgatacaagtgaggcggttatcgaagcccga
aaaagaggaatagaagtgataaatgtttttctctccaactcagaaatagaagaatcgcaa
atgaagacgatccaggatatgtacggaaaattcagtatatttgtcccggatgttgatcag
ctaccggatgttttgtatccgctgctgaaaaaactgcttcataaaagcataggatag

DBGET integrated database retrieval system