KEGG   Bacillus subtilis subsp. subtilis 168: BSU19400
Entry
BSU19400          CDS       T00010                                 

Gene name
sodC
Definition
(RefSeq) superoxide dismutase-like protein YojM
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BSU19400 (sodC)
SSDB
Motif
Pfam: Sod_Cu LPAM_2
Other DBs
NCBI-GeneID: 939502
NCBI-ProteinID: NP_389822
Pasteur: BG13565
BSORF: BG13565
UniProt: O31851
Structure
PDB: 
1XTM 1S4I 1XTL 1U3N

Position
complement(2114742..2115332)
AA seq 196 aa
MHRLLLLMMLTALGVAGCGQKKPPDPPNRVPEKKVVETSAFGHHVQLVNREGKAVGFIEI
KESDDEGLDIHISANSLRPGASLGFHIYEKGSCVRPDFESAGGPFNPLNKEHGFNNPMGH
HAGDLPNLEVGADGKVDVIMNAPDTSLKKGSKLNILDEDGSAFIIHEQADDYLTNPSGNS
GARIVCGALLGNNEKQ
NT seq 591 nt   +upstreamnt  +downstreamnt
atgcaccgtctcttgctgttgatgatgctgacggcactgggagttgccggatgcggacaa
aaaaaacctccagaccctcctaaccgggtgccggaaaaaaaagtggttgaaacgtcagcg
tttggtcatcatgtccagctggtcaatcgtgaagggaaagcagtcggttttatagagatc
aaagaatcagatgatgaaggcctcgatattcatatttccgcaaacagcctgcgtccaggt
gcttctctcggttttcatatttatgagaaaggttcttgtgtcaggccggattttgaatca
gcgggcggtccctttaatccactgaacaaagaacacggctttaataatccgatggggcat
catgccggagatctgccgaaccttgaagtcggtgctgatggaaaggtagatgtcataatg
aatgcgcctgacacttcactgaaaaaaggaagtaaactaaatattctcgacgaggacgga
agtgcatttattattcatgaacaagcggacgattatctgacaaacccaagcggcaattcc
ggtgcgcgtattgtctgcggagcccttttgggaaataacgagaagcagtaa

DBGET integrated database retrieval system