KEGG   Bacillus subtilis subsp. subtilis 168: BSU19420
Entry
BSU19420          CDS       T00010                                 

Gene name
yojK
Definition
(RefSeq) UDP-glucosyltransferase YojK
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_1_3 Glyco_transf_28
Other DBs
NCBI-GeneID: 939457
NCBI-ProteinID: NP_389824
Pasteur: BG13563
BSORF: BG13563
UniProt: O31853
Position
complement(2117051..2118268)
AA seq 405 aa
MANVLMIGFPGEGHINPSIGVMKELKSRGENITYYAVKEYKEKITALDIEFREYHDFRGD
YFGKNATGDEERDFTEMLCAFLKACKDIATHIYEEVKHESYDYVIYDHHLLAGKVIANML
KLPRFSLCTTFAMNEEFAKEMMGAYMKGSLEDSPHYESYQQLAETLNADFQAEIKKPFDV
FLADGDLTIVFTSRGFQPLAEQFGERYVFVGPSITERAGNNDFPFDQIDNENVLFISMGT
IFNNQKQFFNQCLEVCKDFDGKVVLSIGKHIKTSELNDIPENFIVRPYVPQLEILKRASL
FVTHGGMNSTSEGLYFETPLVVIPMGGDQFVVADQVEKVGAGKVIKKEELSESLLKETIQ
EVMNNRSYAEKAKEIGQSLKAAGGSKKAADSILEAVKQKTQSANA
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggctaatgtattaatgatcggtttccccggtgaagggcatattaatccctctatcggt
gtgatgaaggagctgaaatcccggggagaaaacattacgtactacgcagtgaaggaatat
aaagaaaaaatcacagctcttgatatagagtttcgtgagtatcatgatttcagaggagat
tacttcgggaaaaacgcaaccggcgatgaagaaagagatttcacagaaatgctctgcgct
tttttgaaagcctgtaaggatatcgcgactcatatttatgaggaagtcaaacatgaatcg
tatgattatgtcatatatgatcaccatcttctcgcgggtaaagtcattgccaacatgctg
aagctgccaagattttcattgtgtacaacctttgcgatgaatgaggaatttgcgaaggaa
atgatgggagcgtacatgaaaggatcacttgaagattcgcctcattatgaatcataccag
cagcttgcagaaacgttaaatgctgattttcaagcagagatcaagaagccatttgatgtt
tttttagctgatggtgacttgacaatcgtctttacatcaaggggatttcagccactggct
gagcaatttggcgagcgatatgtatttgtcggtccttccattacagaaagagccggaaac
aatgatttcccatttgatcagattgacaatgaaaacgtgctgtttatttcaatgggaacc
atttttaataatcaaaagcagttttttaatcaatgccttgaagtgtgtaaggactttgac
ggtaaagttgtgctttccatcggcaagcatattaaaacaagtgagttaaacgacattccg
gagaatttcattgtacgcccgtatgtccctcagcttgagatcttgaaaagagccagctta
tttgtgacccacggcggaatgaacagcacaagtgaaggtttgtattttgaaaccccgctc
gttgtcattccgatgggaggcgaccaatttgttgtcgcagatcaggtagaaaaagtcggc
gcaggaaaagtaattaaaaaggaagaattgtctgaaagcctactgaaagagacgatacaa
gaagtaatgaataatcgttcgtatgctgaaaaggcaaaagaaattggacaatcactgaaa
gcggcaggcggctctaaaaaagcagccgacagcattcttgaagctgtaaaacaaaaaact
caatcagcaaatgcatag

DBGET integrated database retrieval system