KEGG   Bacillus subtilis subsp. subtilis 168: BSU19430
Entry
BSU19430          CDS       T00010                                 

Gene name
yojJ
Definition
(RefSeq) hypothetical protein
  KO
K18672  diadenylate cyclase [EC:2.7.7.85]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU19430 (yojJ)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.85  diadenylate cyclase
     BSU19430 (yojJ)
SSDB
Motif
Pfam: DAC YojJ BORCS8
Other DBs
NCBI-GeneID: 939589
NCBI-ProteinID: NP_389825
Pasteur: BG13562
BSORF: BG13562
UniProt: O31854
Position
complement(2118504..2119127)
AA seq 207 aa
MKAMRYEQISENAFKGKIQVYLEQILGDASLILKTLHEKDQCLLCELDDLGHVFQDMQGI
ASSFYLQSYIEEFTPAFIELAKAIKALSEHKHGALIVIERADPVERFIQKGTSLHAEISS
SLIESIFFPGNPLHDGALLVRENKLVSAANVLPLTTKEVDIHLGTRHRAALGMSGYTDAL
VLVVSEETGKMSFAKDGVLYPLISPRT
NT seq 624 nt   +upstreamnt  +downstreamnt
atgaaggctatgcgctatgagcagatatcagaaaatgcgttcaaggggaaaatacaggtg
tacttagagcaaatattaggtgatgcatctctaatcttgaaaacgcttcacgaaaaagac
cagtgtctcctttgtgaattagatgatttggggcacgtttttcaggacatgcaggggatt
gcatcctccttttatttgcaatcatacattgaggaatttacgccggcatttattgagctg
gccaaggcgattaaagccttatcggaacataagcatggagctttaattgtgattgaaaga
gcagacccggttgaacgttttattcaaaaaggcacctccctacacgccgagatcagctct
tcattaattgaaagcatcttttttcccggaaaccctcttcatgacggcgctttattagtg
agggaaaacaaactcgtgtcagcagccaatgtgctcccgctgacgacgaaggaagtggat
atccatttgggaacccggcaccgggcggctcttggtatgtcgggctatacggatgcactg
gtgctcgtggtttcagaggaaacagggaagatgtcgtttgccaaagacggtgtattatat
ccgttaatttcaccaagaacgtaa

DBGET integrated database retrieval system