KEGG   Bacillus subtilis subsp. subtilis 168: BSU19440
Entry
BSU19440          CDS       T00010                                 

Gene name
yojI
Definition
(RefSeq) multidrug resistance protein NorM
  KO
K03327  multidrug resistance protein, MATE family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU19440 (yojI)
Transporters [BR:bsu02000]
 Solute carrier family (SLC)
  SLC47: Multidrug and Toxin Extrusion (MATE) family
   BSU19440 (yojI)
SSDB
Motif
Pfam: MatE Polysacc_synt_C
Other DBs
NCBI-GeneID: 939592
NCBI-ProteinID: NP_389826
Pasteur: BG13561
BSORF: BG13561
UniProt: O31855
Position
2119393..2120751
AA seq 452 aa
MKETQNAREKIKQLLHILIPIFITQAGLSLITFLDTVMSGKVSPADLAGVAIGSSLWTPV
YTGLAGILMAVTPIVAQLLGAEKKQKIPFTVLQAVYVAALLSIAVLVIGYAAVDLILGRL
NLDIHVHQIAKHFLGFLSLGIFPLFVYTVLRSFIDSLGKTRVTMMITLSSLPINFVLNYV
FIFGKFGMPALGGVGAGLASALTYWCICIISFFIIHKNAPFSEYGIFLTMYKFSWKACKN
LLKIGLPIGFAVFFETSIFAAVTLLMSHFHTVTIASHQAAMNFASLLYMLPLSVSMALTI
VVGFEAGAARFKDARSYSLIGIMMAIGFSLFTAACILLFREQIAGMYTSDPDVLRLTQHF
LIYALFFQLSDAVAAPIQGALRGYKDVNYTLAAAFVSYWVIGLPVGYMVGTFTSLGAFGY
WIGLIAGLAAGAVGLFFRLAKLQKRYSQKQHI
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgaaagaaactcaaaacgcccgggaaaaaatcaaacagctcttgcacattttaataccg
atattcattacccaagcggggctttctctgatcacttttctagatactgtgatgtcaggg
aaagtcagccccgctgatttagctggtgtcgccattggctcaagcctttggacccctgtt
tacacaggacttgcaggtatattaatggcggtcaccccgattgtcgctcagttattaggt
gcagagaaaaaacagaagattccctttactgttttacaagctgtatacgtggccgcgctt
cttagcatcgccgttttagtgattggatatgctgcagttgaccttattcttggccgattg
aaccttgatattcacgtgcatcagattgctaaacactttttaggctttttatcactggga
attttccctttatttgtttacaccgtgttgagatcattcatcgactcattaggaaaaacg
agagtcaccatgatgattacactcagttctcttccaatcaattttgtattgaattatgta
tttatcttcgggaagttcggaatgccggcacttggaggtgtaggcgcgggactggcatcc
gcgttaacttactggtgtatatgcatcatcagttttttcattattcataaaaacgcaccg
ttttctgaatacgggatttttcttaccatgtataagttctcttggaaagcatgcaaaaat
ttgctcaaaatcgggctgcctattgggttcgccgtgttttttgaaacgagcattttcgca
gctgtcacgcttctcatgagccattttcatacagtgaccatcgcgtcccaccaggcagcc
atgaattttgcgtctcttttatatatgctgccgcttagcgtgtccatggctctaacaatt
gttgtcggatttgaagcgggtgcagcccgttttaaggatgcacgctcatatagcttaatc
ggcatcatgatggcgatcggcttttctttgttcactgccgcctgtatccttttattcaga
gagcaaattgcgggcatgtacacttctgaccccgatgtgctccggctgacacagcacttt
ttaatttatgcgctattttttcagctttccgatgctgttgccgcaccgatccagggagca
ctcagagggtacaaagatgtgaactatacgcttgcggccgcttttgtctcttactgggtc
attggccttccggtcggttatatggtcggtacgtttacaagcctcggtgcattcggctat
tggattggattaatagcgggactcgccgccggagcagttgggctgtttttcaggctggca
aaactgcaaaaacgttattcgcaaaaacaacacatttaa

DBGET integrated database retrieval system