KEGG   Bacillus subtilis subsp. subtilis 168: BSU19450Help
Entry
BSU19450          CDS       T00010                                 

Gene name
rsbRC
Definition
(RefSeq) RsbT co-antagonist protein RsbRC
  KO
K17763  rsbT co-antagonist protein RsbR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU19450 (rsbRC)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     BSU19450 (rsbRC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: STAS STAS_2
Motif
Other DBs
NCBI-GeneID: 940093
NCBI-ProteinID: NP_389827
Pasteur: BG13560
BSORF: BG13560
UniProt: O31856
Position
2120767..2121615
Genome map
AA seq 282 aa AA seqDB search
MAKNKKLFEYLSQHAETISSTWYETIEETDPNSIYASTDPVVIHNLKSQNLAFNYKINRI
FIDDEDVYLPILKEWAFEVTQDQEHLKTPIHYIIREFVRVRDLYVSYVKEFVHLNQNTVK
SEEAEDLYHALIKAFDLVIHIFIEEMYKNTSLQLQAQKDMITELSAPVIVLFHSVGLLPL
IGDIDTVRAKLIMENTLHQCAKKKVTQLYIDLSGVAVIDTMVAHQLFSLIEALRLIGVSS
TLSGIRPEIAQTAVQLGLSFEGISLRSTLASAIASDLKLKKV
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaacaaaaaattattcgagtatctttcccagcatgcggaaaccatcagttca
acatggtatgaaacaatcgaggagactgatcccaattccatttatgcctcaacagaccct
gttgtcattcacaatttaaagagccagaatcttgcctttaactataaaataaaccgtatt
tttatagatgatgaggacgtatacttgcctatactgaaagaatgggcctttgaagtcaca
caggatcaagagcatttaaaaactcctatccactatattattcgggagtttgtcagagtg
agagatttatatgtttcttatgtgaaagaatttgtccatctcaatcagaatactgtgaaa
agcgaagaagccgaagacctgtatcacgcccttataaaagcgtttgatcttgtgattcat
atttttatagaagaaatgtacaaaaacacaagccttcagcttcaggcccaaaaagatatg
attactgaattgagcgctccggtcatcgtgctgtttcacagcgtcggactgctgccttta
atcggagatattgatacagtccgcgccaagctgattatggaaaacacactgcatcaatgt
gcgaaaaaaaaggtgacacaactgtatattgatttgtcaggagtagctgtgattgatacg
atggttgcccatcagctgttcagtctgattgaggcgcttcgtttaatcggtgtttcttca
actttgtctggaatccgtccggaaatcgcgcaaacagcggttcagctaggtttgtctttc
gaaggtatttccttgagatccactctcgcttcagctattgcatcggacttaaaattaaaa
aaggtataa

DBGET integrated database retrieval system