KEGG   Bacillus subtilis subsp. subtilis 168: BSU19460
Entry
BSU19460          CDS       T00010                                 

Gene name
yojG
Definition
(RefSeq) deacetylase YojG
  KO
K22135  N-acetylglucosamine malate deacetylase 2 [EC:3.5.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU19460 (yojG)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     BSU19460 (yojG)
SSDB
Motif
Pfam: PIG-L ERG2_Sigma1R
Other DBs
NCBI-GeneID: 2914250
NCBI-ProteinID: YP_054582
Pasteur: BG13559
BSORF: BG13559
UniProt: O31857
Position
complement(2121641..2122306)
AA seq 221 aa
MKEHVLVILPHPDDESYGVAGLIALNRKKDIPVTYACATLGEMGRNMGDPFFANRETLPL
LRKQELINACKEMDINDLRMLGLRDKTLEFEDDEYLADIMEEIIDDVKPSLIVTFYPGHG
VHPDHDACGEAVIRALYRKKKEDRPRTICMAITRNREEVLGEADVVLDIKEVADIKMNAL
RAHRTQTEGMLRELEEKLKNNEPVMATWFEEEIYWTYQWND
NT seq 666 nt   +upstreamnt  +downstreamnt
atgaaagaacatgtactagtaatcctgcctcaccctgatgatgaatcatatggagtggca
ggcctcattgccttaaacagaaaaaaagacattcccgttacgtatgcctgcgccacttta
ggtgaaatgggcagaaatatgggcgatccatttttcgcgaatcgggaaacgttgccgctg
ctaagaaaacaagagctcatcaacgcttgcaaagaaatggatatcaatgaccttcggatg
cttggactccgtgacaaaacgctcgaatttgaagacgatgagtatttagctgatatcatg
gaagagatcatagatgatgtaaaaccaagtttaattgtcacattttatcccggacacggt
gtgcaccctgaccatgatgcatgcggggaagcggttatccgtgcattataccgcaaaaag
aaagaagaccgtccgcgtacaatctgcatggccattacccgcaacagagaagaggttctc
ggcgaagctgatgtcgtacttgatatcaaagaagtagctgatattaaaatgaatgcgtta
agagctcaccgcacacaaacagaaggcatgctcagagagcttgaagagaaattgaaaaat
aatgaacctgttatggcaacatggtttgaagaagaaatatattggacgtatcaatggaat
gattaa

DBGET integrated database retrieval system