KEGG   Bacillus subtilis subsp. subtilis 168: BSU19470
Entry
BSU19470          CDS       T00010                                 

Gene name
yojF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1806 DUF5793
Other DBs
NCBI-GeneID: 939590
NCBI-ProteinID: NP_389829
Pasteur: BG13558
BSORF: BG13558
UniProt: O31858
Structure
PDB: 
1NJH

Position
complement(2122325..2122675)
AA seq 116 aa
MKAIIKEDVQASLERYADRPVYIHLETTTGSYSAHLNEKNMTVVAYIRNAKVTYHQAKIK
GNGPYRVGLKTEEGWIYAEGLTEYTVDEENRLLMAGHLPGGKLAISLQISEKPFTV
NT seq 351 nt   +upstreamnt  +downstreamnt
atgaaagcgatcataaaagaagatgtgcaagcatctttagaacgatatgcggaccgccct
gtatatatccatttagaaaccaccacaggttcttattcagcgcacttaaatgaaaagaac
atgacggttgttgcgtatattcgcaatgcaaaagtcacttatcatcaggcaaaaatcaaa
ggcaacgggccttaccgcgttggcttgaaaacagaagaaggctggatttatgctgaaggc
ttgactgaatacacggtagatgaagaaaaccgtttattaatggcgggacacctgccgggc
ggtaaactggctatttctctgcaaatcagcgaaaaaccgttcacagtttaa

DBGET integrated database retrieval system