KEGG   Bacillus subtilis subsp. subtilis 168: BSU19479
Entry
BSU19479          CDS       T00010                                 

Gene name
yoyC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3280
Other DBs
NCBI-GeneID: 8303009
NCBI-ProteinID: YP_003097741
UniProt: O68260
Position
complement(2122672..2122950)
AA seq 92 aa
MDNDKEIVKAYASLWNNRSLAHDDAEAVAEAIDLELLDKRTHPRLRKPMLEKYFAAIQRI
VNSQLEPAVKYQLVKLHTERAEYLKEERGEQS
NT seq 279 nt   +upstreamnt  +downstreamnt
atggacaatgataaagagatagtgaaagcctatgcttcactttggaataaccgatctctc
gcacatgatgacgcagaagcggtagcagaggcgattgatcttgagctcttggataaacga
acacatccaagactccgaaaaccgatgctggaaaaatattttgccgcgattcagcgcatt
gtgaattcacagctcgaaccggctgtgaaatatcagctggtcaaattacatacagaacgt
gcagagtatttaaaagaagaaagaggggagcaatcatga

DBGET integrated database retrieval system