KEGG   Bacillus subtilis subsp. subtilis 168: BSU19480
Entry
BSU19480          CDS       T00010                                 

Gene name
yojE
Definition
(RefSeq) transporter
  KO
K05786  chloramphenicol-sensitive protein RarD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU19480 (yojE)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU19480 (yojE)
SSDB
Motif
Pfam: EamA CPP1-like
Other DBs
NCBI-GeneID: 939447
NCBI-ProteinID: NP_389830
Pasteur: BG13557
BSORF: BG13557
UniProt: O31859
Position
complement(2123026..2123922)
AA seq 298 aa
MQHAETKKGVIYTAVSFIMWGLFPLYWKLLEQLPALDILAHRIIWSFVFMCIVLFFLRQW
KIGWQELRSLKKNGGILSLFLASILISINWFVYIWAVNHGFLLEASLGYYINPLVSVLLG
ILFLKEKLNRLQLVAVSIAAAGVIISAFQYGSIPYVALLLAFSFGLYGLSKKRTSLPSAI
GLTLETFMIMPIALGYLLFSGHVQPAGAESGGTWLLLFLAGVFTALPLLLFAEGAKRLPL
YQVGILQYIAPTITLLIGLFVYHEPFSSSKAFTFSCIWAALLLFTFSQVKWKRASKSH
NT seq 897 nt   +upstreamnt  +downstreamnt
atgcaacatgcagaaacaaaaaaaggcgttatttacacagccgtttcatttatcatgtgg
ggcctgtttccgctctattggaagcttctcgaacagctgccggctcttgatattttggct
catcgtattatatggtcttttgtttttatgtgtatcgtactttttttcttgcggcaatgg
aaaataggatggcaggagttgcgctctctgaaaaagaacggagggatcctctctttattt
cttgcttctatcctgatttcgatcaactggtttgtatacatatgggctgtcaaccatggc
tttttgcttgaggctagtcttggctattacattaatccgcttgtatcagtgctccttggg
attttatttttaaaggaaaaactgaatcgcctgcaattagtggccgtttcgattgcggca
gccggtgtcatcatctcggcgttccaatacggctccattccttatgttgcgcttctgctc
gcattcagctttgggctgtacgggttaagcaaaaaaagaacaagcctgccgagcgccatc
ggtttaacgctggaaacattcatgattatgcccattgcattggggtatttgctgttcagc
ggacatgttcagccagcgggtgcagaaagcggagggacgtggctgcttctctttttggcc
ggtgtgtttacggctttgccgctcttattgtttgcggaaggagcgaaacggctgccactg
tatcaagtcggtatcttacaatatattgcgccgaccattaccctgctgatcgggctgttt
gtttaccatgagccattttcaagctcgaaggcttttacattcagctgtatatgggctgcg
ctgctcttgtttacgttttcacaagtgaagtggaaacgggcgtcaaaaagccattga

DBGET integrated database retrieval system