KEGG   Bacillus subtilis subsp. subtilis 168: BSU19490
Entry
BSU19490          CDS       T00010                                 

Gene name
gerT
Definition
(RefSeq) spore germination protein GerT
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: ArsA_HSP20 HSP20
Other DBs
NCBI-GeneID: 2914248
NCBI-ProteinID: YP_054583
Pasteur: BG14190
BSORF: BG14190
UniProt: Q7WY67
Position
2124021..2124494
AA seq 157 aa
MFEWNKYFPFHNQFSKEALKKADPKEVETYVNRVMESVFGSDYAAQFPFRDPLPQKEHPA
KPDAKPDVKPDIDIFETADHVFVKVPISEEWLEQVRIKHTSHELWLENLPRADHPKKVNL
PCLVKRKGTKAVYKDGLLEVMFQKQQDYNMSEVEIIR
NT seq 474 nt   +upstreamnt  +downstreamnt
atgtttgagtggaacaagtactttcctttccacaatcaattttctaaagaagcattaaaa
aaagctgatccgaaagaagttgaaacgtatgtcaatcgtgtgatggaaagtgtgttcggc
agtgattatgcggctcaatttcctttccgcgatcctctcccccaaaaagaacatcccgcc
aaacctgatgcaaaacctgatgtcaaacctgatattgatatattcgaaacagcagaccat
gtgtttgtaaaggtgccaatcagcgaagaatggctggaacaagtgagaatcaaacacaca
tctcacgaattatggttggaaaacctcccaagagcagatcatccgaaaaaagtaaacctt
ccttgtttagtcaaacgcaaaggaacaaaagccgtctataaggatggccttctggaagtc
atgtttcaaaagcagcaagactacaatatgtccgaggtagaaatcatccgataa

DBGET integrated database retrieval system