KEGG   Bacillus subtilis subsp. subtilis 168: BSU19510
Entry
BSU19510          CDS       T00010                                 

Gene name
yojB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1294
Other DBs
NCBI-GeneID: 939446
NCBI-ProteinID: NP_389832
Pasteur: BG13555
BSORF: BG13555
UniProt: O31861
Position
complement(2124529..2124765)
AA seq 78 aa
MYPHHSYLRGIPGPAGYPARSPFLFGAPLVGGLLGGFLGSALFNYSRPYAYPPGPYGYGG
GPYGFGAGVPYGGYPGFY
NT seq 237 nt   +upstreamnt  +downstreamnt
atgtaccctcatcattcgtatttacgcggaatcccaggtccagccggatatccggcgcgt
agtccttttttgtttggcgctcctctagtcggcggtttattaggcggttttctcgggagt
gcgctgtttaactattctcgtccctatgcctatcctcctggcccttatggatatggaggc
ggaccgtacggttttggtgccggcgtgccatacgggggatatcccggcttctattaa

DBGET integrated database retrieval system