KEGG   Bacillus subtilis subsp. subtilis 168: BSU19520
Entry
BSU19520          CDS       T00010                                 

Gene name
yojA
Definition
(RefSeq) permease YojA
  KO
K03299  gluconate:H+ symporter, GntP family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU19520 (yojA)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU19520 (yojA)
SSDB
Motif
Pfam: GntP_permease CitMHS
Other DBs
NCBI-GeneID: 939510
NCBI-ProteinID: NP_389833
Pasteur: BG13554
BSORF: BG13554
UniProt: O31862
Position
complement(2124850..2126184)
AA seq 444 aa
MPILIVAVGVLILLFLIIKVKLNTFVSLIVVSFLVAIGLGMDINKIVLSIETGIGGQLGH
LALVFGLGAMLGRLVSDAGGGYRIAITLIDKFGRKRIQAAVVVASFIIGIALFFEVGLVL
LIPIVYAIAKELKMPFLYLGIPMAAALNVTHGFLPPHPAPTAISVAYGAHIGQVLLFGII
IAVPTTVIAGPLFNKFAMKRFPGAYQKHGNLSGLGPRKEFQLDETPGFAISAVTSLFPVI
FMAMATIFSLLLSEHSKGKDIIEFIGTPGTAMLISLLLALYTMGYARKISMQEIGRSISE
SISQIAMMLLIIGGGGAFKQVLIDGGVGDYVADFFRQTNMSPLFVAWTIAAVLRLCLGSA
TVAALTTAGMAAPLMEAGSVNPALMVLATGAGSVIACHVNDAGFWMVKEFFGLSMKETFQ
TWTLLTTVLSVTGLGCVLLAGLVM
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgccgattttaattgtagctgtcggagtgctgattctgttatttctcattattaaagta
aaattaaatacctttgtctcactgattgtcgtttcatttttagtagccatcggacttgga
atggatatcaataaaattgttctttcaattgagactggaattggcgggcagctggggcat
ttagctttagtgtttggacttggcgcgatgcttgggaggcttgtctcagatgctgggggc
ggctaccggatcgccattacgctgattgacaaattcgggaggaaacgaatacaggcggcg
gttgtggttgcctcttttatcatcgggattgccctattttttgaagtcggtcttgttctg
ttgataccgattgtttacgcgattgctaaagaattaaaaatgccttttctgtatctggga
atcccgatggccgccgccttaaatgttactcacggatttttgcccccgcatcctgctcca
actgctatctcagttgcatatggtgcccatattggccaggtgctgctttttggaatcatc
atcgctgttccgacaactgtgattgccgggcctttatttaataaatttgcgatgaaacgg
tttcctggtgcgtatcaaaagcatggaaacctatcggggttaggaccaaggaaagaattt
cagctggatgaaacaccgggctttgcgatcagtgctgtcacgtctttattcccggttatc
tttatggcaatggcaacaattttttctttattattgagtgaacattcaaaaggaaaagac
attatagaatttatcggcactccgggaacggcaatgctcatttcgctgttgcttgcactc
tatacgatgggatatgcccgtaaaatatctatgcaggaaatcggcagatctatttcagaa
tcaatttcgcaaattgcgatgatgctgctcatcataggagggggaggagcgtttaaacag
gtgctgattgacggcggagtcggcgattatgtcgctgattttttccgtcaaacaaacatg
tcgccgctattcgttgcatggaccatcgccgcggttctgcgtctgtgtctaggctctgct
accgtggctgcgcttaccacagcgggaatggcagctccgcttatggaggctggcagtgta
aaccctgcgttaatggtgcttgcaacaggagccggcagtgtcattgcgtgtcatgtaaat
gatgcaggattttggatggtaaaggaatttttcggcttgagcatgaaagaaacatttcaa
acctggacgctgcttacaacagttctttcggttacagggctcggctgtgtgttattggca
gggcttgtgatgtaa

DBGET integrated database retrieval system