KEGG   Bacillus subtilis subsp. subtilis 168: BSU19530
Entry
BSU19530          CDS       T00010                                 

Gene name
yodA
Definition
(RefSeq) tautomerase YolI
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Tautomerase_2 Tautomerase CAT_RBD
Other DBs
NCBI-GeneID: 939461
NCBI-ProteinID: NP_389834
Pasteur: BG13530
BSORF: BG13530
UniProt: O34882
Position
2126549..2126938
AA seq 129 aa
MPLLRFDVIEGRDEKSLQLLLDTAHQAMVEAFGVPERDRYQIVHQHPANELIIQDAGLGF
QRTKDMVIISMTSKARTESQKEKLYALLAERLEKKCEISPDDLMVSITENGDADWSFGLG
EAQFLNGKL
NT seq 390 nt   +upstreamnt  +downstreamnt
atgccattattgcgttttgatgtaattgagggccgtgatgaaaaatcgctgcaattgtta
ttagatactgctcaccaagcgatggttgaagcatttggtgttccggaaagagaccgttat
caaattgtccatcagcatcccgcaaacgagcttataatccaggatgcgggattagggttt
cagagaaccaaggatatggtcatcattagcatgacaagcaaagcaagaaccgaaagccaa
aaggaaaaattgtatgctctgcttgctgaaaggctagaaaaaaaatgcgaaatttcccct
gacgacctcatggtatctattactgagaatggtgacgcagactggagtttcggtctcggt
gaggcgcaatttttgaatggaaaactataa

DBGET integrated database retrieval system