KEGG   Bacillus subtilis subsp. subtilis 168: BSU19540
Entry
BSU19540          CDS       T00010                                 

Gene name
yodB
Definition
(RefSeq) ArsR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HxlR PadR CHDCT2 HTH_27 HTH_45 SesA MarR
Other DBs
NCBI-GeneID: 939449
NCBI-ProteinID: NP_389835
Pasteur: BG13531
BSORF: BG13531
UniProt: O34844
Structure
PDB: 
5HS7 5HS8 5HS9

Position
complement(2127345..2127683)
AA seq 112 aa
MGNTMCPKMESAFSLLGKRWNGLIIHVLMDGPKRFKEITETIPMISQKMLAERLKELEQN
EIVERQVLPETPVKVIYTLTEKGTALQAVFQEMQAWADQFCEPGDTVCEEEK
NT seq 339 nt   +upstreamnt  +downstreamnt
atgggaaatacgatgtgccctaaaatggaatccgcattctcattgctgggaaaacgatgg
aacggtctgatcatccatgtgctaatggatgggccgaaacggtttaaagagataacggaa
acaataccgatgatcagccaaaaaatgttggcagagcgcttgaaggagcttgaacaaaac
gagattgtcgaacggcaggttctccctgaaacgccggtcaaagtcatctacacgctgact
gaaaaaggaacagcgcttcaagctgtatttcaagaaatgcaggcatgggccgatcaattt
tgcgagcctggtgacacagtgtgtgaagaagagaaataa

DBGET integrated database retrieval system