KEGG   Bacillus subtilis subsp. subtilis 168: BSU19550Help
Entry
BSU19550          CDS       T00010                                 

Gene name
yodC
Definition
(RefSeq) NAD(P)H nitroreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase DUF1246 Xlink
Motif
Other DBs
NCBI-GeneID: 939506
NCBI-ProteinID: NP_389836
Pasteur: BG13532
BSORF: BG13532
UniProt: P81102
Position
2127813..2128421
Genome map
AA seq 202 aa AA seqDB search
MTNTLDVLKARASVKEYDTNAPISKEELTELLDLATKAPSAWNLQHWHFTVFHSDESKAE
LLPVAYNQKQIVESSAVVAILGDLKANENGEEVYAELASQGYITDEIKQTLLGQINGAYQ
SEQFARDSAFLNASLAAMQLMIAAKAKGYDTCAIGGFNKEQFQKQFDISERYVPVMLISI
GKAVKPAHQSNRLPLSKVSTWL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatactctggatgttttaaaagcacgtgcatctgtaaaggaatatgatacaaat
gccccgatctctaaggaggagctgactgagctattagaccttgccactaaagcgccttct
gcttggaaccttcagcattggcattttacagtattccacagcgatgaatcaaaagcggag
cttcttcctgtagcgtataatcaaaaacaaatcgttgagtcttctgctgttgttgccatt
ttaggcgatttaaaggcaaatgaaaacggtgaagaagtttatgctgaattagcaagccaa
ggctatattacggatgaaatcaaacaaacattgctcggccaaatcaacggtgcttaccaa
agcgagcaattcgcacgtgattccgctttcttaaatgcttctttagctgctatgcagctt
atgattgccgcaaaagcaaaaggttatgacacttgcgcaatcggcggatttaacaaagag
cagttccaaaagcaatttgatatcagtgagcgctatgttccggttatgcttatttcaatc
ggcaaagcagtgaagcctgcgcatcaaagcaaccgtctgccgctttcaaaagtatcaact
tggctgtaa

DBGET integrated database retrieval system