KEGG   Bacillus subtilis subsp. subtilis 168: BSU19570
Entry
BSU19570          CDS       T00010                                 

Gene name
yodE
Definition
(RefSeq) ring-cleaving dioxygenase MhqE
  KO
K15975  glyoxalase family protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99999 Others
    BSU19570 (yodE)
SSDB
Motif
Pfam: Glyoxalase
Other DBs
NCBI-GeneID: 940022
NCBI-ProteinID: NP_389838
Pasteur: BG13534
BSORF: BG13534
UniProt: O34543
Position
complement(2129082..2129993)
AA seq 303 aa
MKTEGLHHVTAFARDPQENLRFYTEVLGLRLVKKTVNFDDPGTYHFYFGNQNGDPGTIMT
FFPFQGSGQGTVGKGQAGRVYFSVPSGSLSFWKERLEKSGLSLEEKTLFGEKGLIFDDTE
DLPLAIMEDAKSGKSEWTPDGITTNEAITGMKGVLLYSYDPQATIQLLTESFGYTKVAEE
DQIVRLASSAAVGGVIDVHLHPEKRGVGGYGTVHHVAFRTKKKEQAKWLPIIAENHLPSS
EILDREYFTSVYFREKGGILFEIATDEPGFMTDETFAELGTSLKLPEWLEKHRQQITDIL
PEL
NT seq 912 nt   +upstreamnt  +downstreamnt
atgaaaacagaaggattgcaccatgtcacagcattcgccagagatccgcaagaaaacttg
cgattttatacagaagtgcttgggctcaggctcgttaaaaaaacagtaaactttgatgat
cccggaacgtatcatttttactttgggaatcaaaacggagatcccggtacaataatgacc
ttttttccgttccaaggaagcggacagggaacggtaggaaaaggccaagcgggccgggtg
tacttttcagttccctcaggctccctgtctttttggaaggaacgtcttgagaaaagcggg
ctgagcctagaggaaaaaacgttgtttggtgaaaaaggtcttatttttgatgatacagaa
gaccttccgctggcgatcatggaggatgcgaaaagcggcaaaagcgagtggacgcctgac
gggatcacaacaaatgaagcaattacgggaatgaaaggtgtgctgctatattcctacgac
ccgcaggcgaccatacaattgttaacggaaagctttggatacaccaaagtggccgaagaa
gaccagattgtcagactggcatcttcagcggcggtcggcggtgtcattgatgtccattta
catcctgaaaaaagaggagtcggaggatatggtacggtacaccatgtagcgtttcggact
aagaaaaaggaacaggcgaaatggctgccgattattgctgaaaaccatctgccttcgtca
gaaattctcgacagggaatactttacatcagtttattttagggagaaaggcggtatctta
tttgaaattgccacagatgaaccgggctttatgacagatgaaacgtttgctgagctaggg
acttccttaaaactgcctgaatggctggagaaacatagacaacaaattacagacatttta
cctgaactttaa

DBGET integrated database retrieval system