KEGG   Bacillus subtilis subsp. subtilis 168: BSU19580
Entry
BSU19580          CDS       T00010                                 

Gene name
yodF
Definition
(RefSeq) symporter
  KO
K03307  solute:Na+ symporter, SSS family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU19580 (yodF)
SSDB
Motif
Pfam: SSF Tetraspanin
Other DBs
NCBI-GeneID: 940028
NCBI-ProteinID: NP_389839
Pasteur: BG13535
BSORF: BG13535
UniProt: O34745
Position
2130377..2131867
AA seq 496 aa
MQGNLTALLITAIIVLTVVCIGFLAGRDKSSRTSVEEWSVGGRRFGGLLVWFLVGADLYT
AYTFLGLTSTAFTGGSVAFFAIPYSVLAYFIAYFFLPKLWKVAKIHKLTTLADYARERFN
SKLLASLVAIVGVLMLIPYICLQLSGIQDTLQVAGTGYINVKFVVIISFILVALYTFFSG
IKGPTYTAIIKDILVWVIMLFMVVSLPLIHFNGWTPMIDTLVKEAPQMLTIPSEGPKGIP
WFITASIVSALALFMWAHAATGVFTAKSADAVRKNSMFLPLYNIVLILVIFLGFIAFLVL
PEDTNPRLALLHLIQTSYGGVAQGFAYATIALASLIPCSIMAIGASNLFANNLYRDLIHP
NVSQSKLTLVTRSMVFVVIGLALLFGMLFPTALVTLQLLGVSGMVQIFPAIAVSLFWKNQ
TKEATVIGLLAGLAVTFIVYITQSAHGIYEGFWGLAANMIAVVILNPLFVKNAGSNPVIE
GLFGKKQDANPNQKGA
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgcaagggaatctgactgcacttctcattactgctattattgttttaaccgttgtctgt
atcggctttctcgccggaagagacaaatcctcacgtacttctgtggaagaatggtctgtc
ggcggcagacgcttcggcggtcttctcgtctggtttttagtaggcgctgacctttatacg
gcctatactttcttagggttgaccagtactgcttttacaggcggaagtgttgcatttttc
gccattccttattctgtgttggcctactttatcgcctacttcttcttgccaaaactttgg
aaagttgcgaaaattcataaattaacaacactcgcggattatgcccgggaacgttttaac
agtaagcttttggcaagcctcgttgccatcgttggggtactcatgcttattccgtacata
tgccttcagctgagcggcattcaagacacgcttcaggttgccggcactggctatattaac
gtaaaattcgttgtgatcatttcatttattcttgttgctctttacacattcttcagcggg
attaaagggcccacatatacagccatcattaaggacattttagtatgggtcattatgctg
tttatggtggtgtccctccctctcattcattttaacggctggacgccaatgattgacacg
ttagtgaaggaagcgccgcaaatgctgacgataccgtcagaagggccaaaaggcattcct
tggtttatcacagcatctattgtttccgctctggcactttttatgtgggcacatgccgct
acaggtgttttcacggcgaaaagcgctgatgcagtaagaaaaaacagcatgtttttgccg
ctttataatatcgtgttaattttggttatttttcttggctttatcgcctttcttgttctg
ccggaagatacaaatccaaggctggcgctgctgcatttgattcaaacatcttacggcggc
gtggcacaaggctttgcatatgccactatcgctcttgcttcattaataccttgttccatt
atggcaatcggcgcatcgaatttattcgccaacaacctataccgggatttgattcatccg
aatgtgtcgcaaagcaagctgactcttgtcacacgttcaatggtgtttgttgtcatcggt
cttgcgctgctgtttggaatgctgttcccgactgccttagtgacacttcagctattaggt
gtatccggtatggtgcaaatcttccctgcgattgctgtcagcctgttctggaaaaaccaa
acgaaagaagcaacggttatcggattattagccggcctagcggtaacgtttattgtgtat
atcactcaatccgcacatggcatttatgaaggattctggggattggccgccaacatgatc
gctgtggtcatcctgaatccgctgttcgttaaaaacgcgggatccaatcctgtcattgaa
ggtttatttggcaaaaaacaagacgctaatccaaatcaaaagggcgcataa

DBGET integrated database retrieval system