KEGG   Bacillus subtilis subsp. subtilis 168: BSU19600
Entry
BSU19600          CDS       T00010                                 

Gene name
yodH
Definition
(RefSeq) methyltransferase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_23 Ubie_methyltran Methyltransf_12 TehB RrnaAD Methyltransf_29 Methyltransf_2 MTS NodS DUF938
Other DBs
NCBI-GeneID: 940101
NCBI-ProteinID: NP_389841
Pasteur: BG13536
BSORF: BG13536
UniProt: O34954
Position
2133455..2134156
AA seq 233 aa
MSRYLEMLSLFGVAGAHPGGLAFSKAVLQKAAPSPDQPILDAGCGTGQTAAYLGHLLYPV
TVVDKDPIMLEKAKKRFANEGLAIPAYQAELEHLPFSSESFSCVLSESVLSFSRLTSSLQ
EISRVLKPSGMLIGIEAALKKPMPPAEKKQMMDFYGFTCLHEESEWHKLLRSYGFQKTEA
MSLLPEDMEFEPTTEMDLSQTIDPIYYDTLQTHYQLMQLYSEYMGHCIFIAYK
NT seq 702 nt   +upstreamnt  +downstreamnt
ttgagccgatatttagaaatgctgtccttattcggtgtcgcaggggcgcacccaggcggg
ctggctttttcaaaagcggtcttgcaaaaggctgcaccctctccggatcagccgattctt
gatgccggatgcggaacagggcaaacggcggcttatttaggacatttgctgtatcctgta
acagtcgttgataaagatcctattatgcttgagaaagcgaaaaaaagatttgcgaatgaa
gggcttgccatccctgcatatcaggcggagctggaacatctcccgttttcttctgagtcc
ttttcctgcgtcctgtcagaatcggtcctcagtttttcacgcctgacatcctctcttcaa
gaaatttcaagagttttaaaacccagcgggatgctgattggtatcgaagctgctttaaaa
aaaccaatgccccctgcagaaaagaagcaaatgatggatttttacggatttacttgctta
catgaagaaagcgaatggcataaactcctaagatcctatggctttcaaaaaacagaagcg
atgtcacttcttccggaagacatggaatttgaaccaaccacagaaatggatttatcgcaa
acgattgatcccatctattacgatacgcttcaaacacattatcagctcatgcagttatat
agtgagtacatgggtcattgtatttttatcgcgtacaagtaa

DBGET integrated database retrieval system