KEGG   Bacillus subtilis subsp. subtilis 168: BSU19610
Entry
BSU19610          CDS       T00010                                 

Gene name
yodI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PetG
Other DBs
NCBI-GeneID: 940039
NCBI-ProteinID: NP_389842
Pasteur: BG13537
BSORF: BG13537
UniProt: O34654
Position
2134244..2134495
AA seq 83 aa
MERYYHLCKNHQGKVVRITERGGRVHVGRITRVTRDRVFIAPVGGGPRGFGYGYWGGYWG
YGAAYGISLGLIAGVALAGLFFW
NT seq 252 nt   +upstreamnt  +downstreamnt
ttggagagatattatcatctttgcaaaaaccatcaaggtaaagtcgtcagaattacagag
agaggcgggagagttcacgtcggcagaattacccgtgtaacaagagacagagtttttata
gctccggtcggcggagggccaagaggtttcggttacggatattggggcggttattgggga
tatggagcggcttacgggatttccctcggtttaattgcaggagtggctctggctggttta
ttcttctggtaa

DBGET integrated database retrieval system