KEGG   Bacillus subtilis subsp. subtilis 168: BSU19620
Entry
BSU19620          CDS       T00010                                 

Gene name
yodJ
Definition
(RefSeq) carboxypeptidase YodJ
  KO
K07260  zinc D-Ala-D-Ala carboxypeptidase [EC:3.4.17.14]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00550  Peptidoglycan biosynthesis
bsu01100  Metabolic pathways
bsu01502  Vancomycin resistance
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU19620 (yodJ)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU19620 (yodJ)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BSU19620 (yodJ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU19620 (yodJ)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU19620 (yodJ)
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bsu01504]
    BSU19620 (yodJ)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.14  zinc D-Ala-D-Ala carboxypeptidase
     BSU19620 (yodJ)
Peptidases and inhibitors [BR:bsu01002]
 Metallo peptidases
  Family M15: zinc D-Ala-D-Ala carboxypeptidase family
   BSU19620 (yodJ)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Peptidoglycan biosynthesis and degradation
  Carboxypeptidase
   BSU19620 (yodJ)
Antimicrobial resistance genes [BR:bsu01504]
 Gene sets
  Vancomycin resistance modules
   Vancomycin resistance, D-Ala-D-Lac type [MD:M00651]
    BSU19620 (yodJ)
SSDB
Motif
Pfam: VanY BTRD1 Peptidase_M15_4
Other DBs
NCBI-GeneID: 940023
NCBI-ProteinID: NP_389843
Pasteur: BG13538
BSORF: BG13538
UniProt: O34866
Structure
PDB: 
4OX3

Position
complement(2134566..2135387)
AA seq 273 aa
MKKSGKWFSLAAALSVTAIVGAGCSMSNGDAQKDTKTTAETKQTEQKTADSKKSNTQNSE
FSLESQYFNDIKKVDGLETIQNPENILALVNKQYALPGNYEPSDLVIPDVEFSFEEKIQK
RYIRKEAADALKTMFDAAKKEGYELAAVSGYRSYDRQKVIFDNEVSLKGERKAKEAVAYP
GESEHQTGLAMDISSRSNGFELNEAFGSTADGKWVQDNAYKYGFIIRYPKNKEDITKYEY
EPWHLRYVGKKAAKVIQDNDLTLEEYFEKVKKI
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaaaaagtccggtaaatggttctcactggctgccgctctgagtgtaacggcaatagtc
ggagccggctgcagcatgtcgaacggagatgctcaaaaggatacgaaaaccacagcagaa
acaaagcaaacagaacaaaaaacagctgacagcaaaaaatcaaacactcaaaacagtgag
ttttcattggaaagccagtatttcaatgatattaaaaaagtcgatggtctggaaaccatt
caaaatccagaaaatatactcgcgcttgtcaataaacaatatgcactgcccggaaactat
gaacctagcgatcttgtcatacctgatgtagagttttcttttgaagaaaagattcaaaaa
cgttacatcagaaaagaagcggccgacgcattaaaaacaatgttcgatgctgccaaaaag
gaaggctatgaactggcagctgtctcagggtaccgttcgtatgacagacagaaagtcatt
tttgacaatgaagtaagcctaaaaggggaaaggaaggcaaaggaagcggtcgcttacccg
ggtgaaagcgagcatcaaacaggccttgcgatggacatttcgagccggagcaatggcttt
gagctaaatgaagcgttcggaagcacggcagacgggaaatgggtgcaggacaatgcttat
aaatatggctttattattcgctatccgaaaaataaagaagatatcacgaaatatgaatat
gagccatggcatctgcgctatgtaggcaaaaaagccgcaaaggtcatccaagataatgat
ttaacgcttgaagagtactttgaaaaagtgaagaaaatttaa

DBGET integrated database retrieval system