KEGG   Bacillus subtilis subsp. subtilis 168: BSU19630Help
Entry
BSU19630          CDS       T00010                                 

Gene name
deoD
Definition
(RefSeq) purine nucleoside phosphorylase DeoD-type
  KO
K03784  purine-nucleoside phosphorylase [EC:2.4.2.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00240  Pyrimidine metabolism
bsu00760  Nicotinate and nicotinamide metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU19630 (deoD)
   00240 Pyrimidine metabolism
    BSU19630 (deoD)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BSU19630 (deoD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.1  purine-nucleoside phosphorylase
     BSU19630 (deoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-GeneID: 940038
NCBI-ProteinID: NP_389844
Pasteur: BG12581
BSORF: BG12581
UniProt: O34925
Structure
PDB: 

Position
complement(2135470..2136171)
Genome map
AA seq 233 aa AA seqDB search
MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQ
GTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAF
GSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEME
TTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIEVALHSVSQ
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtacatataggtgctgaaaaaggacaaattgcggatactgtgcttttgccggga
gatcctctcagagcaaaatttattgcagaaacgtatcttgaaaatgtagaatgctacaat
gaagtcagaggcatgtatggatttacgggtacatataaaggtaaaaaaatctcagtacaa
ggcacgggaatgggagttccgtctatttcaatttatgtgaatgaattaattcaaagctac
gatgtgcaaaatctaataagagtcggttcctgcggcgctattcgtaaagatgtcaaagtg
cgagacgtcattttggcgatgacctcctcaactgattcacaaatgaacagagttgctttc
ggaagcgttgattttgcgccttgcgcagatttcgagcttttaaaaaatgcctatgatgcc
gcaaaggataaaggtgtgccggtgactgtaggaagcgtatttacagctgaccagttctac
aatgacgattcgcaaattgaaaaacttgcaaaatacggtgtgcttggcgttgaaatggaa
acaactgcattgtatacattagcagcgaagcacggaagaaaagccctgtcaattctcacc
gtgagtgatcacgtattaacaggagaagaaacgacagcggaagagcgtcaaacgacattt
catgatatgatagaagtggctttacattccgtatcacaataa

DBGET integrated database retrieval system