KEGG   Bacillus subtilis subsp. subtilis 168: BSU19639
Entry
BSU19639          CDS       T00010                                 

Gene name
yoyE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8303105
NCBI-ProteinID: YP_003097743
UniProt: C0H432
Position
2136373..2136498
AA seq 41 aa
MGKKHRNRITGQKKNNHIPEKDIIAAEEAHGKEYSAAKRKP
NT seq 126 nt   +upstreamnt  +downstreamnt
atgggtaaaaaacatcgtaaccggatcaccggccaaaaaaagaacaatcatatacctgaa
aaagatatcattgcagctgaagaagcacacgggaaagaatattccgctgccaaacgcaag
ccttaa

DBGET integrated database retrieval system