KEGG   Bacillus subtilis subsp. subtilis 168: BSU19640
Entry
BSU19640          CDS       T00010                                 

Gene name
yodL
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YodL
Other DBs
NCBI-GeneID: 940030
NCBI-ProteinID: NP_389845
Pasteur: BG13539
BSORF: BG13539
UniProt: O30472
Position
complement(2136538..2136852)
AA seq 104 aa
MMLSVFKKKSCSYDVTIFQTPRFGEKKGYRAVYRTELNGSDHQDVLKRAFSLFNVFDTVP
SDYDARFMATGDVILIDEGRKGKTYYQLLPAGWRKINRLIVQTT
NT seq 315 nt   +upstreamnt  +downstreamnt
atgatgttatccgtgtttaaaaagaagtcttgttcctatgacgtgacaatatttcagaca
ccccggtttggcgaaaaaaagggctacagagccgtctatcgaactgaactgaacgggagc
gatcatcaagacgtgctgaaaagagcattctctttgtttaatgtattcgacactgttccg
agtgattatgatgcaagattcatggccacaggggacgtgatcctgattgatgaaggcaga
aaagggaaaacatattatcaactgcttcccgccggctggaggaaaatcaatcgtctgatt
gtacaaacgacataa

DBGET integrated database retrieval system