KEGG   Bacillus subtilis subsp. subtilis 168: BSU19650
Entry
BSU19650          CDS       T00010                                 

Gene name
yodM
Definition
(RefSeq) lipid phosphate phosphatase YodM
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PAP2 PAP2_3 DUF3185 YhdB PAP2_C
Other DBs
NCBI-GeneID: 940034
NCBI-ProteinID: NP_389846
Pasteur: BG13540
BSORF: BG13540
UniProt: O34349
Structure
PDB: 
6FMX 5JKI

Position
complement(2136913..2137524)
AA seq 203 aa
MYKPVSLFLFFLILAAAIHTNAVQSADEAISKAAVLIRQPWLNEVMTGITHLGASSFLLP
LIVIIGAGMFFYRKTWDGLLMLLVFGTDRLLNKVLKEWIERVRPDFAPLVHESSFSFPSG
HSMNAACVYPVIAYFLVKHLPFLSKHKKMVYIIAGVIAVLVGISRVYLGVHFVTDVLGGF
SLGLLLFFLVKGFDEKIKRFRQK
NT seq 612 nt   +upstreamnt  +downstreamnt
ttgtacaagcccgttagtttgtttcttttctttttaattctagctgcggccattcataca
aatgctgttcaatctgcagatgaagcaataagcaaggcagctgttttgatccgtcagcca
tggcttaatgaagtcatgacggggatcacgcatcttggtgcttcttcttttctgctccct
ctaattgtcatcattggagcaggcatgtttttctacagaaaaacatgggacggcctgttg
atgctcttagtattcggcacagatcggctgttaaacaaagtcttaaaagaatggatcgaa
agagtgaggcctgattttgcaccgctggttcatgaatcatccttcagttttccgagcggc
cattccatgaatgctgcttgtgtctatcctgttattgcttactttttagtgaaacatctc
ccgtttttgtctaagcataaaaaaatggtatatatcatagccggtgtaattgctgtttta
gtcggcataagcagagtgtatctgggggttcattttgtgacagacgtgttaggaggcttt
agcctcggcttgcttctgtttttcctagtaaaaggttttgacgaaaagattaagcggttt
cgacaaaaatag

DBGET integrated database retrieval system