KEGG   Bacillus subtilis subsp. subtilis 168: BSU19660
Entry
BSU19660          CDS       T00010                                 

Gene name
yozD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YozD
Other DBs
NCBI-GeneID: 940042
NCBI-ProteinID: NP_389847
Pasteur: BG13751
BSORF: BG13751
UniProt: O31863
Position
complement(2137602..2137778)
AA seq 58 aa
MKEIDLVIDTEEIAEFFYRELARRGYIPSEDELFEIADITFDYLIEKCMIDEELDEDE
NT seq 177 nt   +upstreamnt  +downstreamnt
atgaaagaaatagatcttgtgattgatacggaagaaatcgctgaatttttttacagagag
cttgcaagacggggctacataccgagtgaggatgagctgtttgaaatcgctgatattacc
tttgattatttgatagaaaaatgtatgatagatgaagagctggatgaagatgagtga

DBGET integrated database retrieval system