KEGG   Bacillus subtilis subsp. subtilis 168: BSU19669
Entry
BSU19669          CDS       T00010                                 

Gene name
yoyF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8303015
NCBI-ProteinID: YP_003097744
UniProt: C0H433
Position
2137897..2138040
AA seq 47 aa
MIAKMMEALDGERFDIIMEKTLKGMTRVMIWGCLPYFLYVLIRMFTN
NT seq 144 nt   +upstreamnt  +downstreamnt
atgattgctaaaatgatggaagcactggacggagaaagatttgatatcataatggaaaaa
acgctcaaaggaatgacgcgtgtgatgatttggggctgtctgccatattttttatatgtc
ttgatccgtatgttcacaaattaa

DBGET integrated database retrieval system