KEGG   Bacillus subtilis subsp. subtilis 168: BSU19670
Entry
BSU19670          CDS       T00010                                 

Gene name
yodN
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2098
Other DBs
NCBI-GeneID: 940037
NCBI-ProteinID: NP_389848
Pasteur: BG13541
BSORF: BG13541
UniProt: O34414
Position
complement(2138037..2138717)
AA seq 226 aa
MKQNKPKFQVGDIVVVIMYGTVGTITKVHQIDKHYLYEVNHNEVLYFESSIQLYKDYEGV
IVDMEKLDIEYEFLIGDVVYVKDYGKELFRIIGHRTEIWRYLEDGWEDIIYELTRLKDGE
WLETEEEDLTLVLRKYEMDQFVHQLLFVHYVGETGHEIGEDIASSALLQFEGGDEDQDTL
HILAVSIVDELLDIYNDYKILYEMFQDEEYKDMMMFVLESLKEHFS
NT seq 681 nt   +upstreamnt  +downstreamnt
atgaagcaaaataaaccgaaattccaagtaggggatatcgtagtcgtcattatgtatgga
acagtcggcaccatcacaaaagtacaccaaattgataaacactatctttatgaagtcaat
cataacgaagttttatactttgaatcatctattcagctttataaagattatgagggtgtc
attgtcgacatggagaagcttgatattgagtatgaattccttattggggacgttgtttat
gttaaagattatggaaaagaactctttcgcattatcggccatagaacagaaatttggaga
tatttagaagatggctgggaagatatcatttatgagctgacccgtttaaaggatggagag
tggcttgaaacggaggaagaggatctcacgctggtgcttagaaaatatgaaatggaccag
tttgtgcatcagctgttgtttgtccattatgtcggagaaactggccatgagatcggcgaa
gatatcgcatcgtctgctcttcttcagtttgaaggcggtgatgaagatcaagataccctt
cacatccttgctgtgtcaattgttgatgagcttctggatatttataatgactacaaaatt
ctgtacgaaatgtttcaggatgaagaatataaagacatgatgatgtttgttttggaaagt
ttaaaagagcatttcagttaa

DBGET integrated database retrieval system