KEGG   Bacillus subtilis subsp. subtilis 168: BSU19680
Entry
BSU19680          CDS       T00010                                 

Gene name
yozE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YozE_SAM_like
Other DBs
NCBI-GeneID: 940055
NCBI-ProteinID: NP_389849
Pasteur: BG13752
BSORF: BG13752
UniProt: O31864
Structure
PDB: 
2FJ6

Position
complement(2138868..2139092)
AA seq 74 aa
MKSFYHYLLKYRHPKPKDSISEFANQAYEDHSFPKTSTDYHEISSYLELNADYLHTMATF
DEAWDQYESEVHGR
NT seq 225 nt   +upstreamnt  +downstreamnt
atgaaatccttttatcactatttattgaaatacagacaccctaagccgaaggacagcatc
agtgaatttgccaatcaggcgtatgaggatcacagctttccaaaaacatcaaccgattat
catgaaatcagttcatatttggagctgaatgctgattaccttcacacgatggcgacgttt
gatgaagcttgggatcaatacgagtctgaagtgcacggcagataa

DBGET integrated database retrieval system