KEGG   Bacillus subtilis subsp. subtilis 168: BSU19689
Entry
BSU19689          CDS       T00010                                 

Gene name
yokU
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YokU zf-C2H2_3 Lar_restr_allev GATA TF_Zn_Ribbon ADK_lid YniB MqsA_antitoxin
Other DBs
NCBI-GeneID: 8303010
NCBI-ProteinID: YP_003097745
UniProt: C0H434
Position
complement(2139179..2139457)
AA seq 92 aa
MKTCEWCGELEAVPGRNTVYWELPDGTRAIELTDTPAMVCSSCGMTYQEENTVKEIEDQL
LLIQTKKLPESLTYQQLMETERILKRNYFDFS
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaaaacatgcgaatggtgcggcgagctcgaagcggtgcccggcaggaacacggtgtac
tgggagctccctgatggaacgagggctatagaactgacagacacccctgccatggtatgt
tcttcctgcggtatgacctatcaagaggaaaacacggttaaagagattgaggatcagctg
cttttaattcaaacaaaaaaactgcctgaaagcctgacatatcagcagctcatggagaca
gaaagaattttgaaacgcaactattttgacttctcctga

DBGET integrated database retrieval system