KEGG   Bacillus subtilis subsp. subtilis 168: BSU19690
Entry
BSU19690          CDS       T00010                                 

Gene name
kamA
Definition
(RefSeq) L-lysine 2,3-aminomutase
  KO
K01843  lysine 2,3-aminomutase [EC:5.4.3.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00310  Lysine degradation
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    BSU19690 (kamA)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.2  lysine 2,3-aminomutase
     BSU19690 (kamA)
SSDB
Motif
Pfam: LAM_C Radical_SAM Fer4_12 Fer4_14
Other DBs
NCBI-GeneID: 940040
NCBI-ProteinID: NP_389850
Pasteur: BG13542
BSORF: BG13542
UniProt: O34676
Position
complement(2139454..2140869)
AA seq 471 aa
MKNKWYKPKRHWKEIELWKDVPEEKWNDWLWQLTHTVRTLDDLKKVINLTEDEEEGVRIS
TKTIPLNITPYYASLMDPDNPRCPVRMQSVPLSEEMHKTKYDLEDPLHEDEDSPVPGLTH
RYPDRVLFLVTNQCSMYCRYCTRRRFSGQIGMGVPKKQLDAAIAYIRETPEIRDCLISGG
DGLLINDQILEYILKELRSIPHLEVIRIGTRAPVVFPQRITDHLCEILKKYHPVWLNTHF
NTSIEMTEESVEACEKLVNAGVPVGNQAVVLAGINDSVPIMKKLMHDLVKIRVRPYYIYQ
CDLSEGIGHFRAPVSKGLEIIEGLRGHTSGYAVPTFVVDAPGGGGKIALQPNYVLSQSPD
KVILRNFEGVITSYPEPENYIPNQADAYFESVFPETADKKEPIGLSAIFADKEVSFTPEN
VDRIKRREAYIANPEHETLKDRREKRDQLKEKKFLAQQKKQKETECGGDSS
NT seq 1416 nt   +upstreamnt  +downstreamnt
ttgaaaaacaaatggtataaaccgaaacggcattggaaggagatcgagttatggaaggac
gttccggaagagaaatggaacgattggctttggcagctgacacacactgtaagaacgtta
gatgatttaaagaaagtcattaatctgaccgaggatgaagaggaaggcgtcagaatttct
accaaaacgatccccttaaatattacaccttactatgcttctttaatggaccccgacaat
ccgagatgcccggtacgcatgcagtctgtgccgctttctgaagaaatgcacaaaacaaaa
tacgatctggaagacccgcttcatgaggatgaagattcaccggtacccggtctgacacac
cgctatcccgaccgtgtgctgtttcttgtcacgaatcaatgttccatgtactgccgctac
tgcacaagaaggcgcttttccggacaaatcggaatgggcgtccccaaaaaacagcttgat
gctgcaattgcttatatccgggaaacacccgaaatccgcgattgtttaatttcaggcggt
gatgggctgctcatcaacgaccaaattttagaatatattttaaaagagctgcgcagcatt
ccgcatctggaagtcatcagaatcggaacaagagctcccgtcgtctttccgcagcgcatt
accgatcatctgtgcgagatattgaaaaaatatcatccggtctggctgaacacccatttt
aacacaagcatcgaaatgacagaagaatccgttgaggcatgtgaaaagctggtgaacgcg
ggagtgccggtcggaaatcaggctgtcgtattagcaggtattaatgattcggttccaatt
atgaaaaagctcatgcatgacttggtaaaaatcagagtccgtccttattatatttaccaa
tgtgatctgtcagaaggaatagggcatttcagagctcctgtttccaaaggtttggagatc
attgaagggctgagaggtcatacctcaggctatgcggttcctacctttgtcgttgacgca
ccaggcggaggaggtaaaatcgccctgcagccaaactatgtcctgtcacaaagtcctgac
aaagtgatcttaagaaattttgaaggtgtgattacgtcatatccggaaccagagaattat
atccccaatcaggcagacgcctattttgagtccgttttccctgaaaccgctgacaaaaag
gagccgatcgggctgagtgccatttttgctgacaaagaagtttcgtttacacctgaaaat
gtagacagaatcaaaaggagagaggcatacatcgcaaatccggagcatgaaacattaaaa
gatcggcgtgagaaaagagatcagctcaaagaaaagaaatttttggcgcagcagaaaaaa
cagaaagagactgaatgcggaggggattcttcatga

DBGET integrated database retrieval system