KEGG   Bacillus subtilis subsp. subtilis 168: BSU19700
Entry
BSU19700          CDS       T00010                                 

Gene name
yodP
Definition
(RefSeq) N-acetyltransferase YodP
  KO
K21935  beta-lysine N6-acetyltransferase [EC:2.3.1.264]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU19700 (yodP)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.264  beta-lysine N6-acetyltransferase
     BSU19700 (yodP)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_9 Acetyltransf_7 Acetyltransf_10 RhoGAP
Other DBs
NCBI-GeneID: 940057
NCBI-ProteinID: NP_389851
Pasteur: BG13543
BSORF: BG13543
UniProt: O34895
Position
complement(2140898..2141725)
AA seq 275 aa
MLKSIKSSGVTAVLDHDGFNKRIRVVRYDGAIEKALPDIVAAAKEENAEKIIVYAKQHDE
PILAKQLFAPEGYLKGYYLGHSACVMVRYLSESRRQTDSYTEEQEIIEAIYRTAPRLRND
STPVFTMRKAETNDMYQLSMLYKKVFRTYPTPVFDPAYIEKTMNANTVYYIMLDHDRLIS
AASAEINPELGHAEITDCAVLPEYRGHSLTSFLIEALEKEMAGEDIVHVFSLARASSFGM
NAVLYHSGYQYGGRLINNCFIAEGLENMNIWCKQL
NT seq 828 nt   +upstreamnt  +downstreamnt
atgctcaagtcaataaagagtagcggtgtcacagcagttttggaccatgacggctttaat
aaacgaatcagagtggttcgttatgacggagccattgagaaggccctgccggatatcgtg
gcagcggcaaaagaagagaatgcagaaaaaatcattgtctatgcgaagcagcatgatgag
ccgatccttgccaaacaattatttgcgccggagggctatctaaagggctattatctcggc
cattcggcttgtgtcatggtacgttacctttcagaaagccggagacaaacagattcttat
acagaggaacaggagatcatcgaagccatatatcgcacagcgccccgtcttcgcaacgac
agtacacccgtttttacgatgagaaaagcagaaacaaacgacatgtaccagctatcgatg
ctgtataaaaaagtattccgcacgtacccaaccccggtatttgaccccgcttatattgaa
aagacgatgaatgcaaatacggtgtattatatcatgcttgatcatgaccgcctgatcagc
gcagcaagcgcagaaatcaatccagagcttgggcatgcagaaataaccgattgcgctgtg
ctgccggaatatcgcggccattcgttaacaagctttttaatcgaggcgttagaaaaagaa
atggctggagaggatatcgttcatgtgttttctctcgcccgtgcttcgtcttttgggatg
aatgctgtgttgtaccattcaggttatcagtatggcggaaggctgatcaataattgcttt
atagccgaaggccttgaaaacatgaatatttggtgcaagcaactgtaa

DBGET integrated database retrieval system