KEGG   Bacillus subtilis subsp. subtilis 168: BSU19710
Entry
BSU19710          CDS       T00010                                 

Gene name
yodQ
Definition
(RefSeq) metallohydrolase YodQ
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00220  Arginine biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BSU19710 (yodQ)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     BSU19710 (yodQ)
SSDB
Motif
Pfam: Peptidase_M20 M20_dimer DUF3762
Other DBs
NCBI-GeneID: 940044
NCBI-ProteinID: NP_389852
Pasteur: BG12569
BSORF: BG12569
UniProt: O34984
Position
complement(2141703..2143013)
AA seq 436 aa
MRMQDIERKVIEWLDQHSAKAIRLLKRLIGEKSTLGSEFNAQAVVLEKLRQFHMDIDVWE
PSIKQLKQHPYFKSNRSDFHESPNIVAKKTGAGGGRSLILNGHIDVVPEGSVKDWKYEPY
QAVEENGKIYGRGSTDMKGGNTALLFALEALHACDVKLKGDVLFQSVVDEECGGAGTLSA
IMRGYRADGALIPEPTNMKLFIKQQGSMWFRITVKGLSAHGGTRYEGVSAIEKSMHVITA
IQELEKVRNARISDPLYDNIPIPVPVNIGTISGGAWPSSVADRVVIEGRCGIAPHEKPEA
VKLELENWLKDLEYHDEWFKRHPVQVEWFGAQWLPNDLPDDHPLISVLQSAYQKMKQTEP
IIEASPWGTDGGLLYHAGDTPVIVFGPGETKTAHQANEYIEVEAMIESAKIIALFVMDWC
GLHTDGEDADAQVNKE
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgaggatgcaagacattgaaagaaaagtaatcgagtggcttgatcagcattcggccaaa
gccattcgtcttctcaaaaggctgattggggaaaaaagcacattggggtcagagtttaac
gcccaagctgttgtgcttgaaaagctgcggcaatttcatatggacattgatgtatgggag
ccaagcataaagcaattaaaacagcatccctactttaaatctaaccgatccgattttcat
gagagcccgaatatcgtggctaaaaaaacgggagccggcggaggcaggtccctgattttg
aacggccatatcgatgttgtgcctgaaggaagcgtaaaggattggaagtatgaaccgtat
caagctgtcgaagaaaacggtaaaatatacggccgcggctcaacggatatgaagggaggc
aatacagcccttctttttgctttagaagccctgcacgcctgcgatgtcaaactgaaggga
gatgtattgtttcagagtgttgtagatgaagagtgcggcggcgccggtacactttccgcc
atcatgagaggctatcgtgctgacggggcgctgattcctgaaccgacgaatatgaaacta
tttattaagcagcagggttcgatgtggtttcggatcactgtgaagggattatccgcacat
gggggcacacgctatgaaggggtaagcgcgattgaaaaaagcatgcacgttatcacagcg
atacaagagctggagaaagtccgcaatgcgagaatttcagatccgctgtatgacaatatc
ccaataccggtaccggtgaatatcggcaccatctcaggcggtgcctggccatcttcagtt
gcagaccgtgtcgtcatagaagggagatgcggaattgctccccatgagaaaccagaagct
gtaaaacttgaattggaaaactggctgaaggatttagaataccatgacgaatggtttaaa
cgccatcccgtacaagtcgaatggtttggcgctcaatggctgccgaatgatttacctgat
gatcaccctttaatttctgtgctgcaatcagcctatcaaaaaatgaaacagacagagccg
attattgaggcttccccgtggggaacggatggagggcttttgtaccatgcaggagataca
ccagtgatcgttttcgggccgggggaaacaaaaacggctcatcaggccaatgaatacatt
gaggttgaagccatgatagaatctgctaaaattattgcactttttgtcatggattggtgc
ggccttcatacagatggggaggatgcggatgctcaagtcaataaagagtag

DBGET integrated database retrieval system