KEGG   Bacillus subtilis subsp. subtilis 168: BSU19720
Entry
BSU19720          CDS       T00010                                 

Gene name
yodR
Definition
(RefSeq) coenzyme A transferase subunit beta
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: CoA_trans DeoRC
Other DBs
NCBI-GeneID: 940048
NCBI-ProteinID: NP_389853
Pasteur: BG13544
BSORF: BG13544
UniProt: O34466
Position
complement(2143022..2143675)
AA seq 217 aa
MGLGVAEREQIAKRAATEIKQGMIVNLGIGIPSLVPNFLKPDMQVMFQAENGVLGIGESP
EKGEEDAHLCNAAGYPVRAVKGASYFDTTMSFAMIRKGKIDITILGALQVSQSGDLANWL
VPGKKVPGMGGAMELAQKAKKVVVVMSHTDQKGRPKLTERCTLPLTAAGCVDLIITEKAV
LEVDSHHFILKELMNGSTIDEVTRLTEAEIKIDMPFS
NT seq 654 nt   +upstreamnt  +downstreamnt
atgggcttgggagtagcagaaagagaacagattgcaaaacgcgctgctactgaaattaag
cagggcatgattgtgaatctcggtatcggtatcccttccttggtaccgaactttttgaag
cctgacatgcaggtcatgtttcaagcggaaaacggtgtccttggcattggagaaagtccc
gaaaagggagaagaggatgcgcatttatgcaacgccgcgggatatcctgtccgcgctgta
aaaggggcttcttattttgatacaaccatgtcttttgcgatgatcagaaaaggcaaaatt
gacattacgattttaggcgccctgcaggtgagccaatcaggagatttggcaaattggctt
gttccgggaaaaaaggtgcctggtatgggcggggcgatggagcttgcccaaaaagcgaaa
aaagtggttgtcgtcatgagtcatacagatcaaaagggaaggcctaaattaacagaaaga
tgtacgctgccattaactgctgcaggctgtgtagatttgattattaccgaaaaagcggtt
cttgaggtcgatagccatcacttcattttaaaagagctgatgaatggctcgacaatcgat
gaggtgacgaggctgacagaagctgaaatcaaaatagatatgcctttttcttaa

DBGET integrated database retrieval system